SRNYLKNPGFETGEFSPWRVSGDKKAVKVVKANPSSNAHQGEYAVNFWLDESFSFELSQEVELPAGVYRVGFWTHGEKGV
KIALKVSDYGGNERSVEVETTGWLEWKNPEIRNIKVETGRIKITVSVEGRAGDWGFIDDFYLFRE
The query sequence (length=145) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2xon:L | 146 | 145 | 1.0000 | 0.9932 | 1.0000 | 3.92e-104 | 2xom:A, 2xon:A |
2 | 3icj:A | 468 | 69 | 0.1517 | 0.0470 | 0.3188 | 2.5 | |
3 | 3oca:A | 179 | 51 | 0.1241 | 0.1006 | 0.3529 | 3.3 | 3oca:B, 3u04:A |
4 | 3ecq:B | 1347 | 34 | 0.0621 | 0.0067 | 0.2647 | 7.1 | 5a55:A, 5a56:A, 5a57:A, 5a58:A, 5a59:A, 5a5a:A, 3ecq:A |