BioLiP

>protein
SRIVVHTQTLFDIVNDGYRWRKYGQKSVKGSPYPRSYYRCSSPGCPVKKHVERSSHDTKLLITTYEGKHDHDMPPG

The query sequence (length=76) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2ayd:A	76	76	1.0000	1.0000	1.0000	3.61e-53
2	8k31:B	79	73	0.6579	0.6329	0.6849	1.83e-35
3	1wj2:A	71	70	0.6053	0.6479	0.6571	1.64e-33	2lex:A
4	8iex:A	88	72	0.5132	0.4432	0.5417	1.33e-23
5	7z0r:A	81	62	0.4737	0.4444	0.5806	7.51e-23	7z0r:B, 7z0u:A
6	6j4f:B	63	63	0.4868	0.5873	0.5873	2.42e-19	6j4f:F
7	7d11:A	79	62	0.4342	0.4177	0.5323	9.57e-19	6j4e:B
8	6j4g:B	58	59	0.4474	0.5862	0.5763	1.74e-18
9	5w3x:D	73	62	0.3816	0.3973	0.4677	5.14e-15	7p8k:B, 5w3x:B
10	6ir8:A	69	59	0.2895	0.3188	0.3729	7.00e-10
11	2ysm:A	111	47	0.1842	0.1261	0.2979	1.3
12	6w1h:A	450	32	0.1447	0.0244	0.3438	1.9
13	6nwz:A	665	21	0.1053	0.0120	0.3810	2.8
14	8j62:C	127	37	0.1711	0.1024	0.3514	4.7	8e40:B, 8j62:G
15	3jcu:E	79	45	0.1842	0.1772	0.3111	4.9	8c29:E, 8c29:e, 3jcu:e, 5mdx:e, 5mdx:E, 7oui:E, 7oui:e, 5xnl:E, 5xnl:e, 5xnm:E, 5xnm:e, 6yp7:e, 6yp7:E
16	2rjb:A	418	28	0.1579	0.0287	0.4286	5.8	2rjb:B, 2rjb:C
17	1br2:A	673	15	0.1053	0.0119	0.5333	6.9	1br2:B, 1br2:C, 1br2:D, 1br2:E, 1br2:F
18	5t45:A	708	15	0.1053	0.0113	0.5333	6.9	5m05:A
19	7mf3:B	896	15	0.1053	0.0089	0.5333	7.0	1br1:A, 1br1:C, 1br1:E, 1br1:G, 1br4:A, 1br4:C, 1br4:E, 1br4:G, 7mf3:A, 6z47:A, 6z47:B
20	4n9f:b	172	37	0.1711	0.0756	0.3514	7.3	8fvi:1, 8fvj:1, 8fvj:6, 8h0i:C, 8h0i:E, 8h0i:G, 8h0i:I, 8j62:E, 8j62:I, 4n9f:G, 4n9f:M, 4n9f:S, 4n9f:d, 4n9f:j, 4n9f:p, 4n9f:v, 4n9f:1, 4n9f:7, 4n9f:q, 4n9f:2
21	7vru:B	494	37	0.1447	0.0223	0.2973	9.8	7vs4:B
22	5ci8:A	117	42	0.1711	0.1111	0.3095	10.0	5ci9:A

[Back]