BioLiP

>protein
SRHSEKIAIRDFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGSRRPWVLGKVMEKEYCQAKKAQNRFK
VPLGTKFYRVKAVSWN

The query sequence (length=96) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8yfk:G	99	99	0.9688	0.9394	0.9394	3.66e-64	7czm:A, 7d0e:A, 8yfk:A, 8yfk:C, 8yfk:E, 8yfl:A, 8yfl:C, 8yfm:A, 8yfm:D, 8yfn:A, 8yfn:C
2	7czm:B	94	96	0.9479	0.9681	0.9479	1.46e-62
3	4d9u:A	307	32	0.1354	0.0423	0.4062	0.074	4d9t:A, 4jg6:A, 4jg7:A, 4jg8:A, 4m8t:A, 4mao:A, 5o1s:A
4	1tzs:A	322	56	0.1979	0.0590	0.3393	0.24
5	1t8t:B	271	59	0.1771	0.0627	0.2881	0.46	1t8t:A, 1t8u:B, 1t8u:A, 6xkg:A, 6xkg:B, 6xl8:A, 6xl8:B
6	4o2z:A	363	35	0.1250	0.0331	0.3429	1.3
7	1smr:A	331	59	0.1875	0.0544	0.3051	1.3	1smr:C, 1smr:E, 1smr:G
8	3ml1:B	109	27	0.1354	0.1193	0.4815	2.6	3o5a:B
9	7m0r:E	458	17	0.1042	0.0218	0.5882	3.0	7m0r:F
10	2ewa:A	330	76	0.1875	0.0545	0.2368	3.5	4e8a:A, 4eh5:A, 1kv2:A, 5ml5:A, 5n63:A, 5omh:A, 2yis:A, 2yiw:A, 3zsi:A, 6zwp:A
11	4gz9:A	562	17	0.1042	0.0178	0.5882	3.6	9eou:A, 4gza:H, 2orz:A, 2qqm:A
12	5wvd:A	241	32	0.1250	0.0498	0.3750	4.0
13	5vdk:A	260	38	0.1354	0.0500	0.3421	5.5
14	3pep:A	326	45	0.1250	0.0368	0.2667	6.5	1psa:A, 1psa:B, 6xct:A, 6xcy:A, 6xcz:A, 6xd2:A
15	3gc8:A	347	75	0.1562	0.0432	0.2000	7.1	3gc8:B, 3gc9:A, 3gc9:B, 3gp0:A, 8ygw:A

[Back]