BioLiP

>protein
SRFKVSKLMAYILRHSPWEFGLEPDEEGFVSIEELVNAVRKVYPWVTEEYIREIVERDEKGRYEIRGNKIRARYGHSYPV
ILRHEEDKESKVLYHGTVRRNLKGIMREGIKPMKRQYVHLSINYEDAYNTGMRHGEDVVVLIIDAECLRNKGYKILKAGK
KVRIVKHVPVDCISGIL

The query sequence (length=177) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8tfx:A	177	177	1.0000	1.0000	1.0000	2.65e-128	8tfy:A, 8tfz:A, 8tfz:B, 8tg5:A, 8tkb:A
2	8tg3:A	187	174	0.4294	0.4064	0.4368	2.99e-43	8tg4:A
3	6e3a:A	180	168	0.4011	0.3944	0.4226	4.67e-39	6ede:A
4	7kw9:A	178	172	0.3559	0.3539	0.3663	3.53e-32
5	7yw3:A	205	171	0.2429	0.2098	0.2515	4.33e-10
6	7yw2:A	206	152	0.2316	0.1990	0.2697	1.79e-08
7	7yw4:A	120	94	0.1469	0.2167	0.2766	0.001
8	2v45:A	723	21	0.0621	0.0152	0.5238	2.0	2jim:A, 2jio:A, 2jip:A, 2jiq:A, 2jir:A, 2nap:A, 2v3v:A
9	5fra:A	197	45	0.0791	0.0711	0.3111	2.4	5fra:B, 5fra:C, 5fra:D, 5fra:E, 5fra:F, 5fre:A, 5fre:B, 5fre:C
10	4v61:BN	176	84	0.1299	0.1307	0.2738	2.8
11	2k60:A	150	56	0.0904	0.1067	0.2857	3.4
12	4pbq:A	304	66	0.0904	0.0526	0.2424	3.8	4pbq:B, 4pbq:C
13	1ncy:A	162	34	0.0734	0.0802	0.3824	4.4	1a2x:A, 1avs:A, 1avs:B, 1cta:A, 1cta:B, 1ctd:A, 1ctd:B, 1jc2:A, 1npq:A, 1smg:A, 1tnq:A, 4tnc:A, 5tnc:A, 1top:A, 2w49:0, 2w49:3, 2w49:6, 2w49:9, 1ytz:C, 1yv0:C
14	4hn1:C	201	66	0.1017	0.0896	0.2727	4.6	4hmz:A, 4hmz:B, 4hmz:C, 4hmz:D, 4hn1:A, 4hn1:B, 4hn1:D
15	2l1w:A	149	37	0.0678	0.0805	0.3243	7.9	2ksz:A, 2roa:A, 2rob:A
16	1wir:A	121	33	0.0452	0.0661	0.2424	8.1
17	6yl2:B	192	48	0.1073	0.0990	0.3958	8.4	6yl2:A

[Back]