BioLiP

>protein
SRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGA
GTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQ
AGCRVAIYLSERL

The query sequence (length=173) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7sss:F	173	173	1.0000	1.0000	1.0000	5.23e-129	7sss:E, 7sss:H, 7sss:G
2	1ez4:B	318	47	0.0925	0.0503	0.3404	0.23	1ez4:A, 1ez4:C, 1ez4:D
3	5y95:A	80	45	0.0636	0.1375	0.2444	0.54
4	7s8t:J	83	58	0.0925	0.1928	0.2759	0.69	7s8t:A, 7s8t:E, 7s8t:F, 7s8t:H, 7s8t:G, 7s8t:I
5	7x0l:A	409	58	0.1156	0.0489	0.3448	0.91	7x0j:A, 7x0j:B, 7x0k:A, 7x0k:B, 7x0l:B, 7x0m:A, 7x0m:B, 7x0n:A, 7x0n:B
6	7l4a:A	223	50	0.1272	0.0987	0.4400	0.96
7	1t2e:A	317	51	0.1040	0.0568	0.3529	1.3	4b7u:B, 4b7u:C, 4b7u:D, 1cet:A, 1ldg:A, 1u4o:A, 1u4s:A, 1u5a:A, 1u5c:A, 1xiv:A
8	2czy:A	77	42	0.0636	0.1429	0.2619	2.4
9	1llc:A	320	39	0.0694	0.0375	0.3077	2.4	6j9t:B, 6j9t:D, 6j9t:E, 6j9t:C, 6j9t:F, 6j9u:A, 6j9u:C, 6j9u:D
10	8gnn:C	259	33	0.0809	0.0541	0.4242	3.6	6j8y:C
11	8vhu:A	743	40	0.0694	0.0162	0.3000	3.6	5cns:A, 5cns:B, 5cns:C, 5cns:D, 5cnt:A, 5cnt:B, 5cnt:C, 5cnt:D, 5cnu:A, 5cnu:B, 5cnu:C, 5cnu:D, 5cnv:A, 5cnv:B, 5cnv:C, 5cnv:D, 4erm:A, 4erm:B, 4erm:C, 4erm:D, 4erp:A, 4erp:B, 4erp:C, 4erp:D, 1r1r:A, 1r1r:B, 1r1r:C, 2r1r:A, 2r1r:B, 2r1r:C, 3r1r:A, 3r1r:B, 3r1r:C, 4r1r:A, 4r1r:B, 4r1r:C, 5r1r:A, 5r1r:B, 5r1r:C, 6r1r:A, 6r1r:B, 6r1r:C, 7r1r:A, 7r1r:B, 7r1r:C, 3uus:A, 3uus:B, 3uus:C, 3uus:D, 8vhn:A, 8vhn:B, 8vho:A, 8vho:B, 8vhp:A, 8vhp:B, 8vhp:C, 8vhp:D, 8vhp:E, 8vhp:F, 8vhp:G, 8vhp:H, 8vhq:A, 8vhq:B, 8vhq:C, 8vhq:D, 8vhr:A, 8vhr:B, 8vhr:C, 8vhr:D, 8vhu:B, 6w4x:A, 6w4x:B, 2x0x:A, 2x0x:B, 2x0x:C, 2xak:A, 2xak:B, 2xak:C, 2xap:A, 2xap:B, 2xap:C, 2xav:A, 2xav:B, 2xav:C, 2xaw:A, 2xaw:B, 2xaw:C, 2xax:A, 2xax:B, 2xax:C, 2xay:A, 2xay:B, 2xay:C, 2xaz:A, 2xaz:B, 2xaz:C, 2xo4:A, 2xo4:B, 2xo4:C, 2xo5:A, 2xo5:B, 2xo5:C
12	3msd:A	330	58	0.0983	0.0515	0.2931	3.7	3msd:B, 3msg:A, 3msg:B, 3mua:A, 3mua:B, 3mui:A, 3mui:B
13	2a92:C	318	41	0.0867	0.0472	0.3659	6.0	2a92:A, 2a92:B, 2a92:D, 2a94:A, 2aa3:A, 2aa3:B, 2aa3:C, 2aa3:D, 4b7u:A, 5hru:A, 5hru:B, 5hto:A, 5hto:B, 5hto:D, 5hto:E, 1oc4:A, 1oc4:B, 4plz:A, 1t24:A, 1t25:A, 1t26:A, 1t2c:A, 1t2d:A, 6txr:A, 6txr:B, 6txr:C, 6txr:D, 3zh2:A, 3zh2:B, 3zh2:C, 3zh2:D
14	1pic:A	112	79	0.1387	0.2143	0.3038	6.2	5aul:A, 7cio:A, 1h9o:A
15	8a22:AN	420	108	0.1792	0.0738	0.2870	6.6	8a22:AM, 8apn:AN, 8apn:AM, 8apo:AN, 8apo:AM
16	7u0l:A	904	26	0.0694	0.0133	0.4615	7.8
17	3k1u:A	314	65	0.0867	0.0478	0.2308	8.1
18	1e91:A	85	40	0.0751	0.1529	0.3250	9.0	1pd7:A

[Back]