SQYALARTFATQKVSLEESVLSQVTTAIQTAQEKIVYAGNGTLSDDDRASLATDLQGIRDQLMNLANSTDGNGRYIFAGY
KTEAAPFDQATGGYHGGEKSVTQQVDSAITLEIGHTGAQIFNSICECAVPEPDGSDSEKNLFVMLDTAIAALKTPVEGNN
VEKEKAAAAIDKTNRGLKNSLHNVLEVRWELEWFLELLSAK
The query sequence (length=201) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5kay:A | 201 | 201 | 1.0000 | 1.0000 | 1.0000 | 1.65e-150 | 5kay:B |
2 | 6wo1:A | 551 | 67 | 0.0896 | 0.0327 | 0.2687 | 0.71 | |
3 | 1oxy:A | 573 | 72 | 0.1045 | 0.0366 | 0.2917 | 0.75 | |
4 | 3gdv:B | 284 | 36 | 0.0697 | 0.0493 | 0.3889 | 0.82 | 3gdu:B, 2r3y:A, 4rqz:A, 4rqz:B, 4rqz:C |
5 | 5k2o:A | 585 | 59 | 0.0846 | 0.0291 | 0.2881 | 1.3 | 3e9y:A, 3ea4:A, 8et4:A, 8et5:A, 5k3s:A, 5k6q:A, 5k6r:A, 5k6t:A, 7stq:A, 7tzz:A, 7u1d:A, 7u1u:A, 7u25:A, 6u9h:A, 6u9h:B, 6u9h:H, 6u9h:I, 6u9h:L, 6u9h:M, 6u9h:P, 6u9h:Q, 6vz8:E, 6vz8:I, 6vz8:M, 6vz8:Q, 5wj1:A, 1ybh:A, 1yhy:A, 1yhz:A, 1yi0:A, 1yi1:A, 1z8n:A |
6 | 4o5v:A | 213 | 38 | 0.0697 | 0.0657 | 0.3684 | 5.3 | 4o6j:A |
7 | 8qca:B | 756 | 41 | 0.0796 | 0.0212 | 0.3902 | 6.1 |