BioLiP

>protein
SQSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLEKLSSSRYQDQAVLFIPAMKRSLAGRYRCSYQNGSLWSLP
SDQLELVATGVFAKPSLSAQPGSGGDVTLQCQTRYGFDQFALYKEGDPERWYRASFPIITVTAAHSGTYRCYSFSSRDPY
LWSAPSDPLELVVTGTSAA

The query sequence (length=179) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5ou9:A	179	179	1.0000	1.0000	1.0000	9.01e-130	5ou8:B, 5ou8:A, 5ou9:B
2	1efx:D	197	198	0.3911	0.3553	0.3535	6.97e-25
3	1efx:D	197	100	0.2179	0.1980	0.3900	2.33e-12
4	1efx:D	197	40	0.0838	0.0761	0.3750	6.4
5	5eiv:A	181	181	0.3296	0.3260	0.3260	2.08e-15	5cjb:A, 5eiv:B
6	5eiv:A	181	93	0.2067	0.2044	0.3978	4.29e-07	5cjb:A, 5eiv:B
7	3kgr:A	99	95	0.2067	0.3737	0.3895	1.28e-13	3kgr:B
8	3kgr:A	99	96	0.1899	0.3434	0.3542	5.38e-06	3kgr:B
9	2cdo:A	138	72	0.1061	0.1377	0.2639	1.3	2cdo:D, 2cdo:C, 2cdo:B, 2cdp:A, 2cdp:D, 2cdp:B, 2cdp:C
10	6exn:J	342	37	0.0782	0.0409	0.3784	4.7	5lj3:J, 5lj5:J, 5mps:J, 5mq0:J
11	7waq:D	365	62	0.0950	0.0466	0.2742	5.3	7vb8:B, 7vb8:A, 7waq:B, 7waq:A, 7waq:C, 7war:B, 7war:A, 7was:A, 7was:B
12	4ybh:A	302	74	0.1117	0.0662	0.2703	6.5	4p2y:A
13	7za1:E	251	66	0.1061	0.0757	0.2879	7.0	7za1:F, 7za1:H, 7za2:E, 7za2:G, 7za3:E, 7za3:G
14	8h72:A	328	54	0.0782	0.0427	0.2593	7.6	8h72:B
15	5j6g:C	276	18	0.0559	0.0362	0.5556	9.0	5j6g:A, 5j6h:A

[Back]