BioLiP

>protein
SQQVWKLVIITEEILLKKVSKIIKEAGASGYTVLAAAGEGSRNVRSTSHAYSNIKFEVLTASRELADQIQDKVVAKYFDD
YSCITYISTVEALRAHKF

The query sequence (length=98) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6ntb:C	104	103	1.0000	0.9423	0.9515	1.56e-65	6mm2:A, 6ntb:A, 6ntb:B
2	6mmo:A	91	98	0.9184	0.9890	0.9184	3.72e-58	6mmc:A, 6mmo:B, 6mmo:C, 6mmo:E, 6mmo:D, 6mmo:F, 6mmq:A, 6mmq:D, 6mmq:B, 6mmq:C, 6mmq:F, 6mmq:E
3	7cyf:D	109	103	0.5714	0.5138	0.5437	9.71e-35	7cyf:E, 7cyf:F, 7egk:D, 7egk:F, 7egk:B, 7obj:A, 7obj:B, 7r2y:C, 7r31:A, 7r31:B, 7r31:C, 7r32:B, 7r32:C
4	7r30:B	102	93	0.5000	0.4804	0.5269	3.24e-30	5o3q:A, 5o3q:C, 5o3q:B, 5o3r:A, 5o3r:B, 5o3r:C, 7obj:C, 7r2y:A, 7r2y:B, 7r2z:A, 7r2z:B, 7r2z:C, 7r30:A, 7r30:C, 7r32:A
5	7o4x:A	103	29	0.1122	0.1068	0.3793	0.36
6	4ojz:A	706	77	0.2041	0.0283	0.2597	1.6	4nei:A, 4nei:B, 4ojz:B, 4ok2:A, 4ok2:B, 4ok4:A, 4ok4:B
7	1z82:A	312	67	0.1633	0.0513	0.2388	2.2	1z82:B
8	5xkt:A	199	26	0.0918	0.0452	0.3462	3.9	5xkt:B
9	9j4i:C	403	66	0.2143	0.0521	0.3182	5.3	9j4i:B, 9j4i:A, 9j4j:A, 9j4j:B, 9j4j:C, 9j4k:B, 9j4k:A, 9j4k:C
10	4wa6:D	415	25	0.1020	0.0241	0.4000	6.0	4w4u:D
11	4fjc:E	434	25	0.1020	0.0230	0.4000	6.0	3m99:A, 3mhh:A
12	3mhs:A	455	25	0.1020	0.0220	0.4000	6.0	6aqr:A, 4fip:A, 4fip:E, 4fjc:A, 4fk5:A, 6t9l:K, 4w4u:A, 4wa6:A, 4zux:U, 4zux:Z, 4zux:e, 4zux:j
13	5hev:F	210	70	0.2347	0.1095	0.3286	9.1	5hev:A, 5hev:B, 5hev:C
14	4eo3:A	321	23	0.0918	0.0280	0.3913	9.3	4eo3:B

[Back]