SQPVFASPLNVEKRRLNEERALMQAQKANIQLPPNYGDMDLILFPEGSLKNSNNTVIPQSHLKGKSVALYFADGADPKCA
The query sequence (length=201) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
7miz:c |
201 |
201 |
1.0000 |
1.0000 |
1.0000 |
3.10e-152 |
7miz:d, 7miz:e, 7miz:f, 7miz:g, 7miz:h, 7miz:j, 7miz:o, 7miz:p, 7miz:q, 7miz:r, 7miz:s, 7miz:t, 7miz:u, 7miz:v, 7miz:n, 7miz:m, 7tnq:c, 7tnq:d, 7tnq:o, 7tnq:p, 7tnq:r, 7tnq:t, 7tnq:u, 7tnq:v, 7tnq:e, 7tnq:m, 7tnq:f, 7tnq:h, 7tnq:i, 7tns:c, 7tns:d, 7tns:o, 7tns:s, 7tns:t, 7tns:v, 7tns:y, 7tns:m, 7tns:f, 7tns:g, 7tns:h |
2 |
7miz:x |
143 |
152 |
0.2687 |
0.3776 |
0.3553 |
1.05e-25 |
7miz:k, 7tnq:w, 7tnq:x |
3 |
3s9f:A |
144 |
101 |
0.1642 |
0.2292 |
0.3267 |
5.82e-09 |
|
4 |
1i5g:A |
144 |
71 |
0.1095 |
0.1528 |
0.3099 |
2.37e-07 |
|
5 |
6gxg:B |
147 |
111 |
0.1493 |
0.2041 |
0.2703 |
1.06e-06 |
6gxg:A, 6gxg:C, 6gxy:A, 6gxy:B, 6gxy:C |
6 |
6ahd:1 |
1048 |
86 |
0.1144 |
0.0219 |
0.2674 |
1.6 |
7abg:u, 7abh:u, 7abi:u, 6ah0:1, 7b0i:C, 7b91:C, 7b9c:C, 8ch6:C, 7dvq:1, 6en4:C, 7evo:1, 6ff4:u, 6ff7:u, 8h6e:2G, 8h6j:2G, 8h6k:2G, 8h6l:2G, 8hk1:1, 8i0p:1, 8i0r:1, 8i0s:1, 8i0t:1, 8i0u:1, 7omf:C, 7onb:C, 7opi:C, 7q3l:A, 7q4o:A, 7q4p:A, 8qo9:B1, 7qtt:C, 6qx9:B1, 8qxd:B1, 8qzs:B1, 8r08:B1, 8r09:B1, 8r0a:B1, 8r0b:B1, 8rm5:B1, 7vpx:1, 6y50:u, 6y5q:u, 8y7e:1, 5z56:1, 5z57:1, 5z58:1, 5zya:C |
7 |
2yi9:A |
771 |
73 |
0.1045 |
0.0272 |
0.2877 |
2.6 |
2yi9:B, 2yi9:C, 2yi9:D, 2yi9:E, 3zed:A, 3zed:B, 3zed:C |
8 |
4yz9:A |
381 |
19 |
0.0498 |
0.0262 |
0.5263 |
8.2 |
4pl4:D, 6w39:A, 6w39:B, 6w3a:A, 6w3a:B, 6w3e:A, 4yz9:B, 4yz9:C, 4yzd:C |
9 |
7bmk:A |
406 |
19 |
0.0498 |
0.0246 |
0.5263 |
8.3 |
7bmk:B, 6hv0:A, 6hx1:A, 3p23:A, 3p23:B, 3p23:C, 3p23:D, 4pl3:A, 4pl3:B, 4pl4:A, 4pl4:B, 4pl4:C, 4pl5:B, 4pl5:A, 4pl5:C, 4pl5:D, 4u6r:A, 6urc:A, 6urc:B, 8uvl:A, 6w3e:B, 6w3k:A, 6xdb:A, 6xdd:A, 6xdd:B, 6xdf:A, 4yzc:A, 4yzc:B, 4yzd:A, 4yzd:B, 4z7h:A, 4z7h:B |
10 |
7ljh:A |
400 |
26 |
0.0647 |
0.0325 |
0.5000 |
8.4 |
7ljh:B |
11 |
1lkx:C |
679 |
89 |
0.1045 |
0.0309 |
0.2360 |
9.3 |
1lkx:A, 1lkx:B, 1lkx:D |