SQKKRSKGSAQDWHRADIVAALHKRGITLAGLSRAHGLAARTLSNAMERHYPRAERLIAQALDMRPEDIWPQRYRN
The query sequence (length=76) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7f9h:A | 76 | 76 | 1.0000 | 1.0000 | 1.0000 | 1.35e-51 | 7f9h:B |
2 | 6za0:A | 240 | 58 | 0.2632 | 0.0833 | 0.3448 | 1.2 | 6z74:A, 6z74:B, 6z74:C, 6z74:D, 6za0:B, 6za3:A, 6za3:B, 6za7:A, 6za7:B, 6za7:C, 6za7:D, 6zab:A |
3 | 6z2w:E | 2325 | 46 | 0.2237 | 0.0073 | 0.3696 | 1.2 | 6z2w:F, 6z2x:E, 6z2x:F, 6z3a:F, 6z3a:E |
4 | 3kfu:F | 447 | 37 | 0.1842 | 0.0313 | 0.3784 | 3.3 | 3kfu:I |
5 | 8tua:A | 1329 | 62 | 0.2500 | 0.0143 | 0.3065 | 3.4 | 5d3x:A, 5d3x:B, 5d3y:A, 5d3y:B, 5fi0:A, 5fi0:C, 5fi0:E, 5fi0:G |
6 | 8k9e:C | 449 | 27 | 0.1579 | 0.0267 | 0.4444 | 5.0 | 8k9f:C, 8x2j:C |
7 | 8owr:B | 229 | 51 | 0.1974 | 0.0655 | 0.2941 | 6.1 | 6th2:B, 6th2:D |
8 | 5eqx:A | 439 | 41 | 0.1842 | 0.0319 | 0.3415 | 7.0 | |
9 | 3h70:A | 342 | 31 | 0.1842 | 0.0409 | 0.4516 | 9.2 |