SQFTCFYNSRANISCVWSQDTSCQVHAWPDRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRW
RVMAIQDFKPFENLRLMAPISLQVVHVETHRCNISWEISQASHYFERHLEFEARTLSPGHTWEEAPLLTLKQKQEWICLE
TLTPDTQYEFQVRVKPLQGEFTTWSPWSQPLAFRTKPAA
The query sequence (length=199) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2erj:B | 204 | 201 | 0.9849 | 0.9608 | 0.9751 | 2.01e-144 | 2erj:F, 5m5e:B, 7s2s:B, 7s2s:D |
2 | 6dg5:B | 206 | 201 | 0.6030 | 0.5825 | 0.5970 | 1.83e-83 | |
3 | 4nzd:A | 210 | 194 | 0.2211 | 0.2095 | 0.2268 | 1.46e-05 | 4nzd:B, 4nzd:C, 3tgx:A, 3tgx:C, 3tgx:E, 3tgx:G, 3tgx:I, 3tgx:K, 3tgx:O, 3tgx:M |
4 | 2gys:B | 406 | 131 | 0.1809 | 0.0887 | 0.2748 | 0.15 | |
5 | 5yvl:D | 206 | 27 | 0.0653 | 0.0631 | 0.4815 | 2.3 | 6al6:A, 6al6:B, 6al7:A, 6al7:B, 6al7:D, 6al7:E, 6al8:A, 6al8:B, 6al8:D, 6al8:E, 5wpp:A, 5wpp:B, 5wpr:A, 5wps:A, 5wpu:A, 5yvl:A, 5yvl:B, 5yvl:C, 5z54:A, 5z54:B, 5z54:C, 5z54:D |
6 | 1eba:A | 212 | 206 | 0.2362 | 0.2217 | 0.2282 | 3.1 | 1eba:B, 1ebp:A, 1ebp:B |
7 | 1bp3:B | 197 | 26 | 0.0603 | 0.0609 | 0.4615 | 5.3 | 3d48:R |
8 | 6j03:A | 200 | 29 | 0.0704 | 0.0700 | 0.4828 | 6.1 | 6a92:A, 6a92:B, 6a92:C, 6a92:D, 6adu:A, 6adu:B, 6adu:C, 6adu:D, 5yvk:A, 5yvp:A, 5yvp:B, 5yvp:C, 5yvp:D, 5z53:A, 5z53:B, 5z53:C, 5z53:D, 5zfj:A, 5zfj:B, 5zfj:C, 5zfj:D |
9 | 3nvn:B | 474 | 42 | 0.0804 | 0.0338 | 0.3810 | 7.8 | |
10 | 1gve:A | 324 | 64 | 0.1106 | 0.0679 | 0.3438 | 9.5 | |
11 | 3wpn:A | 309 | 40 | 0.0804 | 0.0518 | 0.4000 | 9.6 |