BioLiP

>protein
SQFTCFYNSRANISCVWSQDGDTSCQVHAWPDRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGV
RWRVMAIQDFKPFENLRLMAPISLQVVHVETHRCNISWEISQASHYFERHLEFEARTLSPGHTWEEAPLLTLKQKQEWIC
LETLTPDTQYEFQVRVKPLQGEFTTWSPWSQPLAFRTKTGH

The query sequence (length=201) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2erj:B	204	204	1.0000	0.9853	0.9853	2.05e-149	2erj:F, 5m5e:B, 7s2s:B, 7s2s:D
2	6dg5:B	206	199	0.5871	0.5728	0.5930	3.34e-83
3	4nzd:A	210	185	0.2139	0.2048	0.2324	2.50e-04	4nzd:B, 4nzd:C, 3tgx:A, 3tgx:C, 3tgx:E, 3tgx:G, 3tgx:I, 3tgx:K, 3tgx:O, 3tgx:M
4	2gys:B	406	131	0.1791	0.0887	0.2748	0.16
5	5yvl:D	206	27	0.0647	0.0631	0.4815	2.8	6al6:A, 6al6:B, 6al7:A, 6al7:B, 6al7:D, 6al7:E, 6al8:A, 6al8:B, 6al8:D, 6al8:E, 5wpp:A, 5wpp:B, 5wpr:A, 5wps:A, 5wpu:A, 5yvl:A, 5yvl:B, 5yvl:C, 5z54:A, 5z54:B, 5z54:C, 5z54:D
6	1bp3:B	197	26	0.0597	0.0609	0.4615	5.8	3d48:R
7	1eba:A	212	40	0.0697	0.0660	0.3500	6.0	1eba:B, 1ebp:A, 1ebp:B
8	6j03:A	200	29	0.0697	0.0700	0.4828	7.0	6a92:A, 6a92:B, 6a92:C, 6a92:D, 6adu:A, 6adu:B, 6adu:C, 6adu:D, 5yvk:A, 5yvp:A, 5yvp:B, 5yvp:C, 5yvp:D, 5z53:A, 5z53:B, 5z53:C, 5z53:D, 5zfj:A, 5zfj:B, 5zfj:C, 5zfj:D
9	3nvn:B	474	42	0.0796	0.0338	0.3810	10.0

[Back]