SQATSQPINFQVQKDGSSEKSHMDDYMQHPGKVIKQNNKYYFQTVLNNASFWKEYKFYNANNQELATTVVNDNKKADTRT
INVAVEPGYKSLTTKVHIVVPQINYNHRYTTHLEFEKAIPTLA
The query sequence (length=123) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3qzp:B | 125 | 123 | 1.0000 | 0.9840 | 1.0000 | 7.80e-90 | 2itf:A, 2itf:B, 2itf:C, 2itf:D, 3qzl:A, 3qzm:A, 3qzm:B, 3qzn:A, 3qzn:B, 3qzn:C, 3qzo:A, 3qzo:C, 3qzo:B, 3qzo:D, 3qzp:A |
2 | 3sik:A | 123 | 109 | 0.2846 | 0.2846 | 0.3211 | 6.12e-11 | 3sik:B |
3 | 4h8q:A | 119 | 110 | 0.2602 | 0.2689 | 0.2909 | 9.66e-10 | 4h8p:A |
4 | 4ymp:A | 112 | 101 | 0.2033 | 0.2232 | 0.2475 | 0.003 | 4ymp:C |
5 | 2k78:A | 126 | 50 | 0.1545 | 0.1508 | 0.3800 | 0.004 | 2o6p:A, 2o6p:B |
6 | 7pcf:F | 341 | 93 | 0.1951 | 0.0704 | 0.2581 | 0.009 | 7pch:E, 7pch:F, 3rtl:A, 3rtl:B, 3rtl:C, 3rtl:D, 3rur:A, 3rur:B, 3rur:C, 3rur:D, 5vmm:F, 5vmm:E |
7 | 7pcf:F | 341 | 89 | 0.2033 | 0.0733 | 0.2809 | 0.051 | 7pch:E, 7pch:F, 3rtl:A, 3rtl:B, 3rtl:C, 3rtl:D, 3rur:A, 3rur:B, 3rur:C, 3rur:D, 5vmm:F, 5vmm:E |
8 | 7w81:A | 181 | 104 | 0.2033 | 0.1381 | 0.2404 | 0.19 | 3qug:A, 3qug:B, 3quh:A, 3quh:B, 3vtm:A, 3vtm:B, 7w81:B, 2z6f:A |
9 | 8ap0:AAA | 332 | 26 | 0.1057 | 0.0392 | 0.5000 | 0.63 | 8aoz:AAA, 6yqq:A |
10 | 8rf0:A | 2780 | 58 | 0.1057 | 0.0047 | 0.2241 | 1.5 | 8rfe:A, 8rfg:A |
11 | 1g8s:A | 230 | 108 | 0.2195 | 0.1174 | 0.2500 | 2.5 | |
12 | 8c2z:A | 334 | 52 | 0.1220 | 0.0449 | 0.2885 | 3.6 | |
13 | 3wmt:A | 503 | 51 | 0.1220 | 0.0298 | 0.2941 | 4.2 | 3wmt:B |
14 | 8fqc:A | 168 | 27 | 0.1057 | 0.0774 | 0.4815 | 6.7 | |
15 | 7qh2:C | 467 | 24 | 0.0894 | 0.0236 | 0.4583 | 8.1 | 7qh2:F |
16 | 8pz4:A | 466 | 33 | 0.0894 | 0.0236 | 0.3333 | 9.5 | 7acg:A, 4afk:A, 4azl:A, 4azl:B, 4b61:A, 4b61:B, 8q2o:A, 3rbh:A, 3rbh:B, 8rqp:A, 4xnk:A, 4xnl:A |
17 | 3rbh:D | 410 | 33 | 0.0894 | 0.0268 | 0.3333 | 9.7 | 3rbh:C |
18 | 5d5d:A | 403 | 33 | 0.0894 | 0.0273 | 0.3333 | 9.9 |