SQARNQLANKPSKTKVKKEQSLARLYGAKDLNIPTLNRAIVPGVKIRRGKKGKKFIADNDTLTLNRLITTIGDKYDDIAE
SKLEKARRLEEIRELKRKEIERKE
The query sequence (length=104) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8v87:7 | 134 | 120 | 1.0000 | 0.7761 | 0.8667 | 9.10e-64 | 7nac:7, 7r7a:7, 7r7c:7 |
2 | 7r6k:7 | 109 | 104 | 0.8365 | 0.7982 | 0.8365 | 3.84e-42 | |
3 | 8i9t:CX | 88 | 80 | 0.3077 | 0.3636 | 0.4000 | 6.87e-07 | 8i9v:CX, 8i9w:CX, 8i9x:CX, 8i9y:CX, 8i9z:CX, 8ia0:CX |
4 | 5it7:OO | 198 | 52 | 0.1827 | 0.0960 | 0.3654 | 0.086 | 6uz7:AO |
5 | 8c3a:w | 199 | 54 | 0.1635 | 0.0854 | 0.3148 | 0.74 | 8c3a:BJ, 8cq7:w, 8cq7:BJ, 8cqw:w, 8cqw:BJ, 8cre:w, 8cre:BJ, 8oeq:w, 8oeq:BJ, 7pzy:w, 7q08:w, 7q0f:w, 7q0p:w, 7q0r:w, 8q5i:w |
6 | 5xy3:O | 196 | 41 | 0.1442 | 0.0765 | 0.3659 | 0.79 | |
7 | 7zjm:A | 220 | 27 | 0.1058 | 0.0500 | 0.4074 | 0.81 | 6atg:B, 6atg:C |
8 | 6ote:A | 409 | 43 | 0.1250 | 0.0318 | 0.3023 | 2.8 | |
9 | 1jx0:A | 217 | 31 | 0.1346 | 0.0645 | 0.4516 | 3.3 | 1eyq:A, 1eyq:B, 1fm7:A, 1fm7:B, 1fm8:A, 1jep:A, 1jep:B, 1jx1:C |
10 | 4ydp:A | 83 | 46 | 0.1538 | 0.1928 | 0.3478 | 5.6 | 4ydp:B |
11 | 6eu0:V | 273 | 55 | 0.1731 | 0.0659 | 0.3273 | 6.0 | 7q5b:X |
12 | 4dok:A | 208 | 50 | 0.1346 | 0.0673 | 0.2800 | 8.4 |