BioLiP

>protein
SQAIKANNLVFLSGVLGLIPETGKFVSESVEDQTEQVLKNMGEILKASGADYSSVVKTTIMLADLADFKTVNEIYAKYFP
APSPARSTYQVAALPLNAKIEIECIATL

The query sequence (length=108) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5hp8:A	108	108	1.0000	1.0000	1.0000	1.10e-75	5hp8:B, 5hp8:C
2	2b33:B	126	106	0.4444	0.3810	0.4528	9.90e-28
3	7cd4:A	124	106	0.4167	0.3629	0.4245	1.10e-25	7cd4:C
4	8yrc:A	125	108	0.4259	0.3680	0.4259	1.43e-25
5	3k0t:C	124	105	0.4352	0.3790	0.4476	2.54e-25	3k0t:A, 3k0t:B
6	5v4d:A	127	107	0.4444	0.3780	0.4486	4.01e-24	5v4d:B, 5v4d:E
7	2uyk:C	127	108	0.3889	0.3307	0.3889	6.29e-21	2uyn:A, 2uyn:B, 2uyn:C
8	3vcz:B	127	109	0.4074	0.3465	0.4037	2.11e-19
9	3lyb:B	137	129	0.2685	0.2117	0.2248	2.75e-04
10	1dwa:M	499	65	0.1667	0.0361	0.2769	1.1	1dwf:M, 1dwg:M, 1dwh:M, 1dwi:M, 1dwj:M, 1e4m:M, 1e6q:M, 1e6s:M, 1e6x:M, 1e70:M, 1e71:M, 1e72:M, 1e73:M, 1myr:A, 1w9b:M, 1w9d:M, 2wxd:M
11	2p6r:A	683	47	0.1667	0.0264	0.3830	2.0
12	4cj1:A	544	74	0.1944	0.0386	0.2838	3.0	4cj0:A, 1clc:A
13	6et7:A	646	55	0.1667	0.0279	0.3273	3.9	6et7:B
14	5llw:B	673	55	0.1667	0.0267	0.3273	3.9	5llw:A, 5llx:A, 5llx:B, 5lly:D, 5lly:A, 5lly:C, 5lly:B, 6saw:A, 6saw:B, 6saw:C, 6saw:D, 6saw:E, 6saw:F, 6saw:G, 6saw:H, 6sax:B, 6sax:A
15	5bnt:C	371	44	0.1481	0.0431	0.3636	5.2	5bnt:B, 5bnt:A, 5bnt:D
16	6jmu:A	127	91	0.2778	0.2362	0.3297	6.5	6iui:B, 6iui:A, 6jmu:B
17	1dot:A	686	27	0.1111	0.0175	0.4444	8.3	1gv8:A, 1gvc:A, 1ovb:A

[Back]