BioLiP

>protein
SQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEEL
KKKYGI

The query sequence (length=86) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1aca:A	86	86	1.0000	1.0000	1.0000	2.60e-59	2cb8:A, 2cb8:B, 2fj9:A, 1nvl:A
2	3epy:A	88	85	0.6163	0.6023	0.6235	1.83e-32	3epy:B
3	3fp5:A	106	87	0.5349	0.4340	0.5287	1.17e-27
4	2wh5:A	90	86	0.4302	0.4111	0.4302	1.47e-19	2wh5:B, 2wh5:C, 2wh5:D, 2wh5:F, 2wh5:E
5	3flv:A	92	85	0.4302	0.4022	0.4353	1.37e-15	3flv:B
6	7fc7:A	96	89	0.4070	0.3646	0.3933	2.45e-14
7	1hbk:A	89	60	0.2442	0.2360	0.3500	1.53e-09
8	4y0k:A	405	42	0.1279	0.0272	0.2619	0.81	4y1b:A
9	4v4c:A	875	48	0.1628	0.0160	0.2917	2.9	4v4c:C, 4v4c:E, 4v4c:G, 4v4c:I, 4v4c:K, 4v4c:M, 4v4c:O, 4v4c:Q, 4v4c:S, 4v4c:U, 4v4c:W, 4v4d:A, 4v4d:C, 4v4d:E, 4v4d:G, 4v4d:I, 4v4d:K, 4v4d:M, 4v4d:O, 4v4d:Q, 4v4d:S, 4v4d:U, 4v4d:W, 4v4e:A, 4v4e:C, 4v4e:E, 4v4e:G, 4v4e:I, 4v4e:K, 4v4e:M, 4v4e:O, 4v4e:Q, 4v4e:S, 4v4e:U, 4v4e:W
10	8hs7:A	126	27	0.1163	0.0794	0.3704	4.9
11	8df9:A	781	26	0.1279	0.0141	0.4231	7.7
12	8df7:A	850	26	0.1279	0.0129	0.4231	8.2	8df7:B, 8df8:A, 8df8:B, 8df9:B, 8dfb:A, 8dfb:B, 4gfj:A, 3m6k:B, 3m6z:A, 3m6z:B
13	5awp:A	596	26	0.1279	0.0185	0.4231	8.3	5awq:A
14	7xpg:A	463	24	0.1279	0.0238	0.4583	8.4	7xpg:B, 7xpg:C

[Back]