BioLiP

>protein
SPREQDRFLPIANVSRIMKKALPANAKISKDAKETMQECVSEFISFVTGEASDKCQKEKRKTINGDDLLWAMTTLGFEDY
VEPLKVYLQRFRE

The query sequence (length=93) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6r2v:B	93	93	1.0000	1.0000	1.0000	1.47e-66	7cvo:B, 7cvq:B, 7cvq:G, 7cvq:L, 7cvq:Q
2	7c9o:B	85	85	0.8172	0.8941	0.8941	1.10e-53
3	7aw7:B	92	91	0.7204	0.7283	0.7363	3.26e-49	7aw9:B, 4g91:B, 4g92:B, 6y35:B, 6y36:B, 6y37:B, 6y39:B, 6y39:E, 6y39:H
4	4awl:B	92	91	0.7097	0.7174	0.7253	1.59e-48	7ah8:A, 7ah8:C, 6qmp:B, 6qmq:B, 6qms:B, 8qu2:B, 8qu3:B, 8qu4:B
5	1jfi:B	135	84	0.3118	0.2148	0.3452	7.97e-16
6	4wzs:B	113	74	0.2796	0.2301	0.3514	1.65e-09
7	1a7w:A	68	64	0.2258	0.3088	0.3281	7.10e-04	5t5k:A, 5t5k:B, 5t5k:C, 5t5k:D, 5t5k:E, 5t5k:F
8	8epm:A	991	47	0.1290	0.0121	0.2553	0.047
9	7xlq:A	1319	47	0.1290	0.0091	0.2553	0.047	8epl:A, 7yg5:A
10	6qmq:C	84	74	0.2366	0.2619	0.2973	0.083	7ah8:B, 7ah8:D, 4awl:C, 6qmp:C, 6qms:C, 8qu2:C, 8qu3:C, 8qu4:C
11	7aw9:C	118	73	0.2151	0.1695	0.2740	0.58	7aw7:C, 4g91:C, 4g92:C, 6y35:C, 6y36:C, 6y37:C, 6y39:C, 6y39:F, 6y39:I
12	7vfs:A	1266	47	0.1183	0.0087	0.2340	2.4	7vfu:A, 7vfv:A, 7vfw:A
13	7mix:A	1326	47	0.1183	0.0083	0.2340	2.4	7miy:A
14	8x90:A	1377	47	0.1183	0.0080	0.2340	3.5	8x91:A, 8x93:A
15	2x6b:A	287	63	0.1613	0.0523	0.2381	4.2	7n9k:A, 7n9l:A, 6o9t:A, 6o9u:A, 6o9v:A, 6o9v:B, 2x6a:A, 2x6c:A
16	5coc:A	124	55	0.2043	0.1532	0.3455	5.4
17	6en3:A	934	68	0.2043	0.0203	0.2794	5.4	8a49:C, 4nuy:A, 4nuz:A
18	4m54:A	310	25	0.1183	0.0355	0.4400	6.2
19	4mp6:A	334	25	0.1183	0.0329	0.4400	7.8	4mp8:A, 4mpd:A
20	6px9:B	207	52	0.1505	0.0676	0.2692	9.8

[Back]