BioLiP

>protein
SPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPF
CLNIKHKLRQQQ

The query sequence (length=92) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5hpd:A	158	92	1.0000	0.5823	1.0000	2.85e-63	2ka6:A, 2kje:A
2	5hp0:A	122	92	1.0000	0.7541	1.0000	1.20e-62
3	3t92:A	113	89	0.8913	0.7257	0.9213	1.26e-56
4	7xez:A	163	87	0.8587	0.4847	0.9080	2.17e-54	8e1d:A, 1f81:A, 2mzd:A, 7xfg:A
5	6fgs:A	130	87	0.8587	0.6077	0.9080	3.41e-54
6	6fgn:A	124	87	0.8587	0.6371	0.9080	4.53e-54
7	3io2:A	109	84	0.8370	0.7064	0.9167	2.72e-52	3p57:P
8	1ea0:A	1452	32	0.1522	0.0096	0.4375	0.018	1ea0:B
9	6s6t:A	1472	32	0.1522	0.0095	0.4375	0.018	6s6s:A, 6s6s:B, 6s6s:C, 6s6s:D, 6s6t:B, 6s6t:C, 6s6t:D, 6s6u:A, 6s6u:B, 6s6u:C, 6s6u:D, 6s6u:E, 6s6u:F, 6s6x:A, 6s6x:B, 6s6x:C, 6s6x:D, 6s6x:E, 6s6x:F, 2vdc:A, 2vdc:B, 2vdc:C, 2vdc:D, 2vdc:E, 2vdc:F
10	5hou:A	171	78	0.3043	0.1637	0.3590	0.099	2ka4:A, 1l3e:B, 1l8c:A, 7lvs:B, 2lww:A, 1p4q:B, 7qgs:A, 1r8u:B, 1u2n:A
11	3ntl:A	388	38	0.1957	0.0464	0.4737	1.8	3ntl:B
12	7b1s:B	466	13	0.1087	0.0215	0.7692	5.7	7b1s:E, 7b2c:B, 7b2c:E
13	8s91:A	602	28	0.0978	0.0150	0.3214	8.8	7dp3:A, 8s91:B, 8s91:C, 8s94:A, 8s94:C, 8s94:B
14	7wi7:A	565	28	0.0978	0.0159	0.3214	9.2

[Back]