BioLiP

>protein
SPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPF
CLNIKHK

The query sequence (length=87) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5hpd:A	158	87	1.0000	0.5506	1.0000	8.69e-60	2ka6:A, 2kje:A
2	5hp0:A	122	87	1.0000	0.7131	1.0000	2.70e-59
3	7xez:A	163	87	0.9080	0.4847	0.9080	1.92e-54	8e1d:A, 1f81:A, 2mzd:A, 7xfg:A
4	6fgs:A	130	87	0.9080	0.6077	0.9080	3.42e-54
5	6fgn:A	124	87	0.9080	0.6371	0.9080	4.39e-54
6	3t92:A	113	84	0.8851	0.6814	0.9167	2.42e-53
7	3io2:A	109	84	0.8851	0.7064	0.9167	2.60e-52	3p57:P
8	5hou:A	171	77	0.3218	0.1637	0.3636	0.100	2ka4:A, 1l3e:B, 1l8c:A, 7lvs:B, 2lww:A, 1p4q:B, 7qgs:A, 1r8u:B, 1u2n:A
9	1ea0:A	1452	23	0.1149	0.0069	0.4348	0.20	1ea0:B
10	6s6t:A	1472	23	0.1149	0.0068	0.4348	0.20	6s6s:A, 6s6s:B, 6s6s:C, 6s6s:D, 6s6t:B, 6s6t:C, 6s6t:D, 6s6u:A, 6s6u:B, 6s6u:C, 6s6u:D, 6s6u:E, 6s6u:F, 6s6x:A, 6s6x:B, 6s6x:C, 6s6x:D, 6s6x:E, 6s6x:F, 2vdc:A, 2vdc:B, 2vdc:C, 2vdc:D, 2vdc:E, 2vdc:F
11	3ntl:A	388	38	0.2069	0.0464	0.4737	1.1	3ntl:B
12	7b1s:B	466	13	0.1149	0.0215	0.7692	4.9	7b1s:E, 7b2c:B, 7b2c:E
13	8s91:A	602	28	0.1034	0.0150	0.3214	7.3	7dp3:A, 8s91:B, 8s91:C, 8s94:A, 8s94:C, 8s94:B
14	7wi7:A	565	28	0.1034	0.0159	0.3214	7.5
15	7t3u:A	2020	47	0.1494	0.0064	0.2766	9.9	7t3u:D

[Back]