BioLiP

>protein
SPKCTECLQYLDDPELRYEQHPPDAVEEIQILTNERLSIFDANESGFESYEDLPQHKLTCFSVYCKRGHLCPIDTGLIEK
DVELLFSGSAKPIYEDDPSPEGGINGKNFGPINEWWIAGFDGGEKALLGFSTSFAEYILMDPSPEYAPLFSVMQEKIYIS
KIVVEFLQSNPDSTYEDLINKIETTVPPCMLNLNRFTEDSLLRHAQFVVEQVESYDRAGDSDEQPIFLSPCMRDLIKLAG
VT

The query sequence (length=242) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6pzv:G	242	242	1.0000	1.0000	1.0000	0.0	6pzv:C
2	4wxx:B	1178	241	0.8306	0.1706	0.8340	2.06e-138	3epz:A, 3epz:B, 7lmk:A, 7lmk:B, 7lmk:C, 7lmk:D, 7lmm:A, 7lmm:B, 7lmm:C, 7lmm:D, 3pta:A, 7sfc:A, 7sfd:A, 7sfe:A, 7sff:A, 7sfg:A, 5wvo:C, 4wxx:A, 6x9i:A, 6x9j:A, 6x9k:A, 7xi9:A, 7xib:A, 5ydr:B, 4yoc:A
3	3av4:A	1140	241	0.7190	0.1526	0.7220	1.03e-119	3av5:A, 3av6:A, 4da4:B, 5gut:A, 5guv:A, 3pt9:A, 6w8v:B, 6w8w:A, 6w8w:B, 5wy1:A
4	7wuy:A	393	97	0.0868	0.0534	0.2165	1.5	7wuy:B, 7wvs:A, 7wvs:B, 7ww0:A, 7ww0:B
5	4dx9:2	91	42	0.0537	0.1429	0.3095	2.3
6	3v7f:B	220	39	0.0537	0.0591	0.3333	4.2	3toc:A, 3toc:B, 3v7f:A
7	5wzg:A	534	81	0.0950	0.0431	0.2840	7.1	5wzh:A, 5wzi:A, 5wzj:A
8	8x6f:D	1176	144	0.1529	0.0315	0.2569	7.1	8x6g:D
9	5wzk:A	513	81	0.0950	0.0448	0.2840	7.4
10	8ojc:A	395	17	0.0413	0.0253	0.5882	7.7
11	9enp:A	1072	17	0.0413	0.0093	0.5882	9.2	9enq:A, 8oja:A
12	8v1t:A	1064	17	0.0413	0.0094	0.5882	9.6
13	8v1q:A	1097	17	0.0413	0.0091	0.5882	9.7	8exx:A, 7luf:A, 7luf:B, 8oj6:A, 8oj7:A, 8ojb:A, 8ojd:A, 8v1r:A, 8v1s:A, 8vq2:A, 8vq2:B

[Back]