SPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQIARA
The query sequence (length=78) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2jwo:A | 82 | 78 | 1.0000 | 0.9512 | 1.0000 | 1.59e-56 | 8t4r:A, 2v83:A, 2v83:B, 2v83:C, 2v85:A, 2v85:B, 2v86:B, 2v86:A, 2v87:A, 2v87:B, 2v88:A, 2v88:B, 2v89:B, 2v89:A |
2 | 8sm5:I | 138 | 30 | 0.1282 | 0.0725 | 0.3333 | 2.4 | |
3 | 2wh6:A | 157 | 30 | 0.1282 | 0.0637 | 0.3333 | 2.8 | 7p33:B, 7p33:D, 7p33:A, 7p33:E, 7p9w:A, 8sm5:A, 8sm5:C, 8sm5:G, 8sm5:E, 2v6q:A, 2xpx:A |
4 | 7lbe:C | 299 | 29 | 0.1667 | 0.0435 | 0.4483 | 3.8 | 7lbf:C, 7lbg:C |
5 | 8fia:A | 1772 | 24 | 0.1282 | 0.0056 | 0.4167 | 4.6 | |
6 | 8bz6:A | 606 | 50 | 0.1923 | 0.0248 | 0.3000 | 4.9 | 8bz6:B, 8bz6:C, 8bz6:D, 8bz6:E, 8bz6:F, 8bz7:A, 8bz7:B, 8bz7:C, 8bz7:D, 8bz7:E, 8bz7:F, 8bz8:A, 8bz8:B, 8bz8:C, 8bz8:D, 8bz8:E, 8bz8:F |
7 | 3oft:A | 396 | 24 | 0.0897 | 0.0177 | 0.2917 | 7.3 | 3oft:B, 3oft:C, 3ofu:A, 3ofu:B, 3ofu:C, 3ofu:D, 3ofu:E, 3ofu:F |
8 | 4fxo:B | 227 | 31 | 0.1282 | 0.0441 | 0.3226 | 9.5 | 4fxo:A, 4fxo:C, 4fxo:D |