SPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQRE
VAQQFTHARRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANR
RKEEA
The query sequence (length=165) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8pi9:B | 177 | 168 | 0.9939 | 0.9266 | 0.9762 | 2.61e-119 | 1ic8:A, 1ic8:B, 8pi7:A, 8pi7:B, 8pi8:A, 8pi8:B, 8pi9:A, 8pia:A, 8pia:B |
2 | 2h8r:A | 176 | 165 | 0.8485 | 0.7955 | 0.8485 | 2.25e-104 | 2h8r:B |
3 | 4j19:A | 77 | 73 | 0.1515 | 0.3247 | 0.3425 | 1.25e-04 | 4j19:B |
4 | 8x7u:D | 654 | 59 | 0.1091 | 0.0275 | 0.3051 | 2.5 | 8x7u:E, 8x7u:C, 8x7u:B, 8x7u:F, 8x7u:A |
5 | 3wcc:C | 342 | 38 | 0.0727 | 0.0351 | 0.3158 | 4.0 | 3wca:A, 3wca:B, 3wca:C, 3wca:D, 3wcb:A, 3wcb:B, 3wcb:D, 3wcc:A, 3wcc:B, 3wcc:D, 3wce:A, 3wce:B, 3wce:C, 3wce:D, 3wcg:A, 3wcg:B, 3wcg:C, 3wcg:D, 3wsb:A, 3wsb:B, 3wsb:C, 3wsb:D |
6 | 1fjl:A | 65 | 73 | 0.1212 | 0.3077 | 0.2740 | 5.0 | 1fjl:B, 1fjl:C |