SPADAVGQIRQNATQVLTILKSGDAASARPKAEAYAVPYFDFQRMTALAVGNPWRTASDAQKQALAKEFQTLLIRTYSGT
MLKFKNATVNVKDNPIVNKGGKEIVVRAEVGIPGQKPVNMDFTTYQSGGKYRTYNVAIEGTSLVTVYRNQFGEIIKAKGI
DGLIAELKAKNG
The query sequence (length=172) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8dte:A | 172 | 172 | 1.0000 | 1.0000 | 1.0000 | 1.02e-125 | |
2 | 5uwa:A | 185 | 138 | 0.2442 | 0.2270 | 0.3043 | 2.58e-15 | 5uwa:B |
3 | 3b6u:B | 343 | 106 | 0.1512 | 0.0758 | 0.2453 | 1.6 | 3b6u:A |
4 | 4kwh:B | 257 | 38 | 0.0872 | 0.0584 | 0.3947 | 2.8 | 4kwh:A, 4kwi:A, 4kwi:B, 4oso:A, 4oso:B |
5 | 4zgf:A | 141 | 32 | 0.0756 | 0.0922 | 0.4062 | 6.4 |