SNTRNFVLRDEDGNEHGVFTGKQPRQAALKAANRGSGTKANPDIIRLRERGTKKVHVFKAWKEIVDAPKNRPAWMPEKIS
KPFVKKERIEKLE
The query sequence (length=93) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2nbj:A | 93 | 93 | 1.0000 | 1.0000 | 1.0000 | 1.08e-64 | |
2 | 5fih:A | 438 | 33 | 0.1290 | 0.0274 | 0.3636 | 0.46 | 5o9o:A, 5o9p:A, 5o9q:A, 5o9r:A, 5o9y:A, 5oa2:C, 5oa6:A, 2w62:A, 2w63:A |
3 | 4pqi:A | 238 | 14 | 0.0968 | 0.0378 | 0.6429 | 2.2 | |
4 | 2g3f:A | 414 | 31 | 0.1613 | 0.0362 | 0.4839 | 2.4 | 2bb0:A, 2bb0:B, 2g3f:B |
5 | 4dwr:B | 486 | 53 | 0.1505 | 0.0288 | 0.2642 | 4.9 | 8dc9:A, 8dc9:B, 8dca:A, 8dca:B, 8dcb:A, 8dcb:B, 8dcd:A, 8dcd:B, 8dcf:A, 8dcf:B, 8dcg:A, 8dcg:B, 4dwq:A, 4dwq:B, 4dwr:A, 4dwr:C, 4isj:A, 4isj:B, 4isz:A, 4isz:B, 4it0:A, 4it0:B, 7lfq:A, 1uc2:A, 1uc2:B |
6 | 1zgs:A | 442 | 25 | 0.0968 | 0.0204 | 0.3600 | 5.3 | 4mq0:A, 1zgs:B |
7 | 6cxh:A | 382 | 16 | 0.0968 | 0.0236 | 0.5625 | 5.9 | 7s4l:A, 7s4l:D, 7s4l:E |
8 | 3chx:A | 362 | 19 | 0.1075 | 0.0276 | 0.5263 | 9.3 | 3chx:E, 3chx:I |
9 | 5enz:B | 373 | 61 | 0.1828 | 0.0456 | 0.2787 | 9.4 | 5enz:A |
10 | 1v72:A | 345 | 19 | 0.1183 | 0.0319 | 0.5789 | 9.4 |