BioLiP

>protein
SNPADHFRPNLKALTLYAERQHYVDRWLHVKERWLAPWYLPWWSPLFQLGTWYSQRSRNLFLVENHLSYRPYKFRRNDED
RNNPY

The query sequence (length=85) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8ap6:Q	85	85	1.0000	1.0000	1.0000	9.98e-59	8ap6:q, 8ap7:Q, 8ap7:q, 8apd:q, 8apf:q, 8apg:q, 8aph:q, 8apj:q
2	5kj5:B	484	21	0.1176	0.0207	0.4762	1.6	4i1w:A, 4i1w:B, 4i1w:C, 4i1w:D, 4i25:A, 4i25:B, 4i25:C, 4i25:D, 4i2r:A, 4i2r:B, 4i2r:C, 4i2r:D, 5kj5:A, 5kj5:D, 5kj5:C, 5klk:A, 5klk:B, 5klk:D, 5klk:C, 5kll:A, 5kll:B, 5kll:C, 5kll:D, 5klm:A, 5klm:B, 5klm:C, 5klm:D, 5kln:A, 5kln:D, 5kln:B, 5kln:C, 5klo:A, 5klo:B, 5klo:C, 5klo:D, 4npi:A, 4npi:B, 4npi:C, 4npi:D, 4oe2:A, 4oe2:B, 4oe2:C, 4oe2:D, 4ou2:A, 4ou2:B, 4ou2:C, 4ou2:D, 4oub:A, 4oub:B, 4oub:C, 4oub:D
3	8atf:G	442	37	0.1765	0.0339	0.4054	2.5	8oo9:G, 8oos:G
4	8oo7:G	704	36	0.1765	0.0213	0.4167	3.1	8oop:G
5	5jxt:M	324	34	0.1647	0.0432	0.4118	3.3	5jxt:N, 5jxt:O, 5jxt:J, 5jxt:K, 5jxt:I, 5jxt:H
6	6fml:G	731	36	0.1765	0.0205	0.4167	3.4	8av6:G
7	7dei:B	377	24	0.1294	0.0292	0.4583	4.1	7dei:A
8	6pwf:K	454	34	0.1647	0.0308	0.4118	4.4
9	4gby:A	475	32	0.1059	0.0189	0.2812	4.6	4gbz:A, 4gc0:A
10	6d2y:A	428	20	0.0824	0.0164	0.3500	6.1
11	6sna:A	265	43	0.1647	0.0528	0.3256	7.4	6sna:B, 6sna:F, 6sna:G, 6sna:J, 6sna:K, 6sna:N, 6sna:X
12	2crw:A	149	28	0.1294	0.0738	0.3929	8.1

[Back]