SNITYVKGNILKPKSYARILIHSCNCNGSWGGGIAYQLALRYPKAEKDYVEVCEKYGSNLLGKCILLPSYENSDLLICCL
FTSSFGEKQSILNYTKLALDKLKTFREIGDYLNGHIKYPIGEYKLEMPQINSGIAGVPWKETERVLEEFSGDMSFTVYQL
The query sequence (length=160) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6lfr:A | 166 | 166 | 0.9938 | 0.9578 | 0.9578 | 3.94e-112 | 6lfs:A, 6lft:A, 6lfu:A, 6lfu:B |
2 | 5m3e:A | 152 | 151 | 0.2188 | 0.2303 | 0.2318 | 1.79e-04 | |
3 | 7epu:B | 748 | 159 | 0.2437 | 0.0521 | 0.2453 | 0.002 | 8b0a:K, 7enn:K, 7otq:K |
4 | 4ryk:A | 295 | 97 | 0.1875 | 0.1017 | 0.3093 | 0.92 | |
5 | 2l8r:A | 150 | 42 | 0.0875 | 0.0933 | 0.3333 | 1.3 | 4j5r:A, 4j5r:B, 4j5s:A, 4j5s:B, 4j5s:C, 4j5s:D |
6 | 6ui4:A | 692 | 42 | 0.0813 | 0.0188 | 0.3095 | 4.1 | |
7 | 6gbn:B | 435 | 79 | 0.1062 | 0.0391 | 0.2152 | 4.3 | 6gbn:A, 6gbn:C, 6gbn:D |
8 | 3hbz:A | 341 | 101 | 0.1688 | 0.0792 | 0.2673 | 5.5 | |
9 | 4fln:B | 464 | 35 | 0.0938 | 0.0323 | 0.4286 | 7.7 | 4fln:A, 4fln:C |
10 | 5kis:A | 1446 | 67 | 0.1313 | 0.0145 | 0.3134 | 8.6 | |
11 | 6lqk:A | 173 | 29 | 0.0875 | 0.0809 | 0.4828 | 9.5 |