SNITYVKGNILKPKSYARILIASCNCNGSWGGGIAYQLALRYPKAEKDYVEVCEKYGSNLLGKCILLPSYENSDLLICCL
FTSSFGGSSHGEKQSILNYTKLALDKLKTFREAIGDYLNGHIKYPIGEYKLEMPQINSGIFGVPWKETERVLEEFSGDMS
FTVYQL
The query sequence (length=166) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6lfr:A | 166 | 166 | 0.9940 | 0.9940 | 0.9940 | 3.76e-121 | 6lfs:A, 6lft:A, 6lfu:A, 6lfu:B |
2 | 5m3e:A | 152 | 152 | 0.1988 | 0.2171 | 0.2171 | 1.08e-04 | |
3 | 2l8r:A | 150 | 42 | 0.0843 | 0.0933 | 0.3333 | 1.9 | 4j5r:A, 4j5r:B, 4j5s:A, 4j5s:B, 4j5s:C, 4j5s:D |
4 | 3bvo:A | 197 | 92 | 0.1446 | 0.1218 | 0.2609 | 2.4 | 3bvo:B |
5 | 1a80:A | 277 | 22 | 0.0602 | 0.0361 | 0.4545 | 4.3 | 1m9h:A |
6 | 8h9d:A | 1114 | 31 | 0.0783 | 0.0117 | 0.4194 | 4.3 | |
7 | 4fln:B | 464 | 35 | 0.0904 | 0.0323 | 0.4286 | 8.1 | 4fln:A, 4fln:C |