BioLiP

>protein
SNIAGMIVFLDPGHNGANDASIGRQVPTGRGGTKNCQESGTATDDGYPEHSFTWDTTLRVRAALTALGVRTAMSRGNDNA
LGPCVDERAAMANSLRPHAIVSIHADGGPPTGRGFHVLYSSPPLNAAQSGPSVQFAKVMRDQLAASGIPPATYIGQGGLN
PRSDIAGLNLAQFPSVLVECGNMKNPVDSALMKSPEGRQKYADAIVRGIAGFLGSQ

The query sequence (length=216) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7agm:A	218	216	1.0000	0.9908	1.0000	9.21e-161	7agm:B
2	4m6g:A	214	214	0.7963	0.8037	0.8037	7.86e-131	4lq6:A, 4m6i:A, 4m6i:B
3	7ago:A	214	211	0.6759	0.6822	0.6919	1.33e-107	7agl:A
4	5j72:A	638	196	0.2130	0.0721	0.2347	3.62e-10	5j72:B
5	4rn7:A	186	216	0.2361	0.2742	0.2361	1.25e-07
6	8c0j:A	200	221	0.2824	0.3050	0.2760	1.18e-06	8c0j:C
7	7rag:B	197	220	0.2083	0.2284	0.2045	1.40e-06
8	5emi:A	180	210	0.2593	0.3111	0.2667	2.09e-06
9	7tj4:B	176	217	0.2454	0.3011	0.2442	1.27e-05	7tj4:D
10	8c2o:A	228	241	0.2685	0.2544	0.2407	1.55e-05	8c2o:B
11	4bin:A	348	231	0.2361	0.1466	0.2208	1.73e-05
12	1jwq:A	179	166	0.1852	0.2235	0.2410	0.002
13	7b3n:B	170	116	0.1528	0.1941	0.2845	0.002	7b3n:A, 7b3n:C, 7b3n:D, 7b3n:E
14	3ne8:A	226	50	0.0787	0.0752	0.3400	0.010
15	8dek:B	441	69	0.0833	0.0408	0.2609	0.26	8dek:A, 8df2:A, 8df2:B, 8df2:C, 8df2:D
16	6vwf:A	450	64	0.0787	0.0378	0.2656	9.6	6vwf:B
17	6s85:B	356	50	0.0694	0.0421	0.3000	9.9	7yzp:B

[Back]