BioLiP

>protein
SNFLDLQKQRRSIYALGKTVDLSKAELVALIQNAIKQAPSAFNSQTSRALVLFGQDSQDFWNKIAYSELEKVTPAEAFAG
TKAKLESFAAGVGTILLFEDQAVVRNLEENFPLYAENFQPWSEQAHGIALYAIWLALAEQNIGMSVQHYNPLVDAQVAEK
YDLPTNWKMRAQIPFGSIEAPAGEKEFMADQERFKVFGD

The query sequence (length=199) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2ifa:B	201	199	1.0000	0.9900	1.0000	3.47e-147	2ifa:A, 2ifa:C, 2ifa:D, 2ifa:E, 2ifa:F
2	4bn9:A	191	195	0.4874	0.5079	0.4974	4.88e-64	4bn6:A, 4bn7:A, 4bn8:A, 4bnb:A, 2wqf:A
3	8cqv:A	202	197	0.4221	0.4158	0.4264	1.94e-54	8cqv:B
4	1ywq:A	199	197	0.3618	0.3618	0.3655	3.71e-46
5	3ge6:A	210	58	0.0955	0.0905	0.3276	0.032	3ge6:B
6	7nfc:A	3562	59	0.0704	0.0039	0.2373	0.50	8bh3:S, 8bh3:A, 8bhv:A, 8bhv:F, 8bhy:A, 8bhy:S, 8bot:F, 8bot:S, 7nfc:F
7	7ojl:L	1498	48	0.0704	0.0093	0.2917	2.6
8	7ojj:L	1785	48	0.0704	0.0078	0.2917	2.6
9	7ojk:L	1843	48	0.0704	0.0076	0.2917	2.6
10	7ojn:L	2010	48	0.0704	0.0070	0.2917	2.7	5j1n:A, 5j1p:A, 4miw:A, 7oe7:L
11	4xoq:A	204	62	0.0854	0.0833	0.2742	3.4	4xoo:A, 4xoo:B, 4xoo:C, 4xoo:D, 4xoq:B, 4xoq:C, 4xoq:D
12	3e39:A	175	129	0.1709	0.1943	0.2636	3.7	3e39:B
13	1wkr:A	340	111	0.1256	0.0735	0.2252	5.4
14	7oe3:L	1478	37	0.0553	0.0074	0.2973	6.5	7oea:L, 7oeb:L
15	7och:L	1181	37	0.0553	0.0093	0.2973	6.9
16	7qep:S4	259	35	0.0653	0.0502	0.3714	7.5
17	1v9n:A	348	66	0.1055	0.0603	0.3182	9.5

[Back]