SNDSSDPLVVAASIIGILHLILWILDRLFFK
The query sequence (length=31) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2ly0:A | 31 | 31 | 0.9677 | 0.9677 | 0.9677 | 3.38e-15 | 2muw:C |
2 | 2rlf:C | 38 | 27 | 0.8710 | 0.7105 | 1.0000 | 1.35e-12 | |
3 | 3of1:A | 246 | 21 | 0.2903 | 0.0366 | 0.4286 | 0.88 | |
4 | 6slf:A | 398 | 19 | 0.3548 | 0.0276 | 0.5789 | 1.5 | 6slf:B, 6slf:C, 6slf:D |
5 | 1qle:A | 538 | 17 | 0.2581 | 0.0149 | 0.4706 | 6.6 | 1ar1:A, 7ate:A, 7atn:A, 7au3:A, 7au6:A, 3ehb:A, 3hb3:A |