BioLiP

>protein
SNARFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKK

The query sequence (length=76) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3ew0:A	77	73	0.9605	0.9481	1.0000	6.05e-52	6de9:A, 3ew0:B, 4ezf:A, 4ezf:B, 4f1e:A, 4f1e:B, 4f1e:C, 4f1e:D, 4f1e:E, 4f1e:F, 4f1e:G, 4f1e:H, 4f1e:I, 4f1e:J, 4f1e:K, 4f1e:L, 4f1e:M, 4f1e:N, 4f1e:O, 4f1e:P, 4f1e:Q, 4f1e:R, 4f28:A, 4f28:B, 4f2c:A, 4f2c:B, 3lpq:A, 3lpq:B, 7p0o:A, 7p0o:B, 2qd0:A, 2qd0:B, 2qh7:A, 2qh7:B, 2r13:A, 3ree:A
2	3fnv:B	68	64	0.5789	0.6471	0.6875	3.05e-29	3fnv:A, 4oo7:A, 4oo7:B, 4ooa:A, 4ooa:B, 4ooa:C, 4ooa:D, 4ooa:E, 4ooa:F, 7p0p:A, 7p0p:B, 7p0p:C, 7p0p:D
3	7yvz:A	63	62	0.5000	0.6032	0.6129	7.47e-26
4	3s2r:B	78	62	0.4079	0.3974	0.5000	2.77e-17	3s2q:A, 3s2q:B, 3s2r:A
5	3tbn:A	87	17	0.1447	0.1264	0.6471	0.046
6	3tbn:A	87	26	0.1447	0.1264	0.4231	1.2
7	3tbm:A	61	22	0.1447	0.1803	0.5000	0.12	3tbm:B
8	6z1p:AV	129	55	0.2632	0.1550	0.3636	0.13
9	6avj:A	92	16	0.1447	0.1196	0.6875	0.26	6avj:B, 6avj:C
10	3tbo:A	54	22	0.1579	0.2222	0.5455	0.44
11	5tbd:G	112	33	0.1711	0.1161	0.3939	1.6	5tbd:F, 5tbd:B, 5tbd:K
12	7ase:f	1523	40	0.1579	0.0079	0.3000	3.1	7ask:F
13	2xn2:A	729	60	0.2105	0.0219	0.2667	4.0
14	8any:e	238	55	0.2105	0.0672	0.2909	5.5	3j7y:e, 7odr:e, 7ods:e, 7odt:e, 8oir:Bv, 8oit:Bv, 8pk0:e, 7po4:e, 7qi4:e, 7qi5:e, 7qi6:e, 8qsj:e, 6zm5:e, 6zm6:e
15	2zze:A	744	23	0.1316	0.0134	0.4348	8.3	2zze:B, 2zzf:A, 2zzg:A, 2zzg:B

[Back]