SNAMKHTIGILGGMGPAATADMLEKFVELRHASCDQQHIPLIVSSIPDIPDRTACLLSGGPSPYRYLERYLHMLEDAGAE
CIVIPCNTAHYWFDDLQNVAKARMISILDATLGDIPPSARHVGLLATNATLATGLYQKKALARGLTLIQPEDAGQALVMQ
AIYTLKRGDKTAAQALLLPQIDSLIARGAQAIIMGCTEIPLIVAGHERAIACPMIDSTASLVRAAIRWYESWPDT
The query sequence (length=235) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3s7z:B | 235 | 235 | 1.0000 | 1.0000 | 1.0000 | 4.93e-175 | |
2 | 2dx7:A | 228 | 224 | 0.3404 | 0.3509 | 0.3571 | 7.02e-41 | |
3 | 5wxy:A | 227 | 222 | 0.2894 | 0.2996 | 0.3063 | 6.53e-18 | 5wxz:A, 5xni:A, 5xnj:A, 5xnk:A |
4 | 3ojc:A | 230 | 160 | 0.2213 | 0.2261 | 0.3250 | 6.19e-14 | 3ojc:B |
5 | 5elm:B | 235 | 150 | 0.2043 | 0.2043 | 0.3200 | 2.50e-07 | 5elm:C, 5elm:D, 5hra:A, 5hra:B, 5hrc:A, 5hrc:B |
6 | 1zuw:C | 262 | 167 | 0.1957 | 0.1756 | 0.2754 | 3.35e-05 | 1zuw:A, 1zuw:B |
7 | 3uhf:A | 255 | 140 | 0.1617 | 0.1490 | 0.2714 | 2.29e-04 | 3uhf:B, 3uho:A, 3uho:B |
8 | 1b74:A | 252 | 160 | 0.1574 | 0.1468 | 0.2313 | 5.95e-04 | |
9 | 2ohv:A | 258 | 181 | 0.1745 | 0.1589 | 0.2265 | 0.23 | |
10 | 6dli:A | 256 | 134 | 0.1489 | 0.1367 | 0.2612 | 0.80 | 6dli:B, 6dli:C, 6dli:D, 5w16:A, 5w16:B, 5w16:C, 5w16:D |
11 | 3out:B | 264 | 150 | 0.1489 | 0.1326 | 0.2333 | 0.91 | 3out:A, 3out:C |
12 | 5fvc:D | 369 | 62 | 0.0638 | 0.0407 | 0.2419 | 1.4 | 5fvc:A, 5fvc:B, 5fvc:C, 5fvc:E, 5fvc:F, 5fvc:G, 5fvc:H, 5fvc:I, 5fvc:J, 5fvd:A, 5fvd:C, 8pdl:A, 8pdm:A, 8pdn:A, 8pdn:B, 8pdn:C, 8pdn:D, 8pdn:E, 8pdn:F, 8pdn:G, 8pdn:H, 8pdn:I, 8pdn:J, 8pdn:K, 8pdn:L, 8pdo:A, 8pdo:B, 8pdp:A, 8pdq:A, 8pdr:A, 8pdr:B, 8pdr:C, 8pdr:D, 8pdr:E, 8pdr:F, 8pdr:G, 8pdr:H, 8pdr:I, 8pdr:J, 8pdr:K, 8pds:A, 8pds:C |
13 | 5ijw:B | 276 | 132 | 0.1277 | 0.1087 | 0.2273 | 1.6 | 5ijw:A |
14 | 5odc:B | 291 | 98 | 0.1234 | 0.0997 | 0.2959 | 2.6 | 5odc:H, 5odh:B, 5odh:H, 5odi:B, 5odi:H, 5odq:B, 5odq:H, 5odr:B, 5odr:H |
15 | 3bu7:B | 358 | 49 | 0.0638 | 0.0419 | 0.3061 | 3.9 | 3bu7:A |
16 | 5oql:E | 331 | 44 | 0.0511 | 0.0363 | 0.2727 | 4.9 | 6rxt:UF, 6rxu:UF, 6rxv:UF, 6rxy:UF, 6rxz:UF |
17 | 7cns:B | 131 | 59 | 0.0681 | 0.1221 | 0.2712 | 5.1 | |
18 | 5v85:B | 279 | 22 | 0.0426 | 0.0358 | 0.4545 | 6.6 | 5v85:A |
19 | 3lop:A | 353 | 67 | 0.0851 | 0.0567 | 0.2985 | 9.2 |