SNAMILVPIDISDERIISHVESEARIDDAEVHFLTVIPSLGMDELREGSETQLKEIAKKFSIPEDRMHFHVAEGSPKDKI
LALAKSLPADLVIIASHRPDITTYLLGSNAAAVVRHAECSVLVVR
The query sequence (length=125) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3fdx:A | 127 | 129 | 0.9840 | 0.9685 | 0.9535 | 7.53e-80 | 3fdx:B, 3fh0:A, 3fh0:B |
2 | 4r2l:A | 142 | 142 | 0.7680 | 0.6761 | 0.6761 | 1.80e-61 | 4r2l:B, 4r2m:A, 4r2m:B |
3 | 3tnj:A | 130 | 132 | 0.3040 | 0.2923 | 0.2879 | 9.46e-07 | |
4 | 5cb0:A | 290 | 121 | 0.2640 | 0.1138 | 0.2727 | 1.89e-06 | 5cb0:B, 4r2j:A |
5 | 4wy2:A | 308 | 88 | 0.2160 | 0.0877 | 0.3068 | 2.58e-06 | |
6 | 3hgm:A | 147 | 74 | 0.2080 | 0.1769 | 0.3514 | 1.85e-05 | 3hgm:B, 3hgm:C, 3hgm:D |
7 | 2z09:A | 124 | 54 | 0.1600 | 0.1613 | 0.3704 | 0.002 | 2z08:A |
8 | 1mjh:B | 144 | 135 | 0.2720 | 0.2361 | 0.2519 | 0.004 | 1mjh:A |
9 | 2gm3:A | 153 | 55 | 0.1360 | 0.1111 | 0.3091 | 0.010 | 2gm3:B, 2gm3:C, 2gm3:D, 2gm3:E, 2gm3:F |
10 | 3loq:A | 273 | 60 | 0.1360 | 0.0623 | 0.2833 | 0.030 | 3loq:B |
11 | 3s3t:A | 145 | 146 | 0.2960 | 0.2552 | 0.2534 | 0.033 | 3s3t:B, 3s3t:C, 3s3t:D, 3s3t:E, 3s3t:F, 3s3t:G, 3s3t:H |
12 | 5ahw:C | 146 | 52 | 0.1520 | 0.1301 | 0.3654 | 0.13 | |
13 | 5ahw:B | 127 | 52 | 0.1520 | 0.1496 | 0.3654 | 0.15 | 5ahw:A, 5ahw:D, 5ahw:E, 5ahw:F |
14 | 6n7l:C | 344 | 111 | 0.2640 | 0.0959 | 0.2973 | 1.0 | 6n7l:A, 6n7l:B, 6n7l:D, 6n7l:E, 6n7l:F, 6n7l:G, 6n7l:H, 6n7l:I, 6n7l:J, 6n7l:K, 6n7l:L |
15 | 8u51:A | 267 | 64 | 0.1520 | 0.0712 | 0.2969 | 1.9 | |
16 | 8bcj:B | 250 | 56 | 0.0960 | 0.0480 | 0.2143 | 2.4 | 8bcj:A, 8bcj:C, 8bcj:D |
17 | 7oq6:A | 399 | 48 | 0.1360 | 0.0426 | 0.3542 | 2.9 | 7oq6:B |
18 | 1lnz:A | 342 | 29 | 0.1040 | 0.0380 | 0.4483 | 3.0 | 1lnz:B |
19 | 3gvh:A | 318 | 26 | 0.0960 | 0.0377 | 0.4615 | 3.0 | 3gvh:B, 3gvh:C, 3gvh:D, 3gvi:A, 3gvi:B, 3gvi:C, 3gvi:D, 3gvi:E, 3gvi:F |
20 | 3x1l:H | 297 | 34 | 0.1120 | 0.0471 | 0.4118 | 4.1 | |
21 | 8ct0:H | 178 | 47 | 0.1120 | 0.0787 | 0.2979 | 9.6 | 8ct0:A, 8ct0:B, 8ct0:C, 8ct0:G, 8ct0:D, 8ct0:E, 8ct0:F |
22 | 7na0:A | 981 | 20 | 0.0720 | 0.0092 | 0.4500 | 9.6 | 7na0:B, 4nm9:A, 4nm9:B, 4nma:A, 4nma:B, 4nmb:A, 4nmb:B, 4nmc:B, 4nmd:A, 4nmd:B, 4nme:A, 4nme:B, 4nmf:A, 4nmf:B |
23 | 3u4j:A | 505 | 39 | 0.0880 | 0.0218 | 0.2821 | 9.8 | |
24 | 4nmc:A | 941 | 20 | 0.0720 | 0.0096 | 0.4500 | 9.9 |