SNAMIKQLFTHTQTVTSEFIDHNNHMHDANYNIIFSDVVNRFNYSHGLSLKERENLAYTLFTLEEHTTYLSELSLGDVFT
VTLYIYDYDYKRLHLFLTLTKEDGTLASTNEVMMMGINQHTRRSDAFPESFSTQIAHYYKNQPTITWPEQLGHKIAIP
The query sequence (length=158) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5eo2:C | 158 | 158 | 1.0000 | 1.0000 | 1.0000 | 1.75e-117 | 5eo2:B, 5eo2:E, 5eo2:F |
2 | 5eo2:A | 133 | 154 | 0.8418 | 1.0000 | 0.8636 | 1.57e-88 | |
3 | 5eo2:D | 120 | 154 | 0.7595 | 1.0000 | 0.7792 | 2.76e-78 | |
4 | 2gf6:A | 134 | 123 | 0.1835 | 0.2164 | 0.2358 | 0.11 | 2gf6:B, 2gf6:C, 2gf6:D |
5 | 2np0:A | 1289 | 72 | 0.1392 | 0.0171 | 0.3056 | 0.22 | 1epw:A, 2etf:A, 2etf:B, 1f31:A, 1f82:A, 6g5f:B, 6g5g:B, 6g5k:A, 6g5k:B, 1g9a:A, 1g9b:A, 1g9c:A, 1g9d:A, 1i1e:A, 4kbb:A, 4kbb:B, 7na9:A, 2nm1:A, 6qns:A, 1s0b:A, 1s0c:A, 1s0d:A, 1s0e:A, 1s0f:A, 7t5f:A, 7t5f:D, 2xhl:A, 3zuq:A, 6zvm:AAA |
6 | 5t2o:A | 293 | 49 | 0.1013 | 0.0546 | 0.3265 | 2.7 | |
7 | 8bif:A | 318 | 53 | 0.1076 | 0.0535 | 0.3208 | 3.5 | 8bif:B, 8bif:C, 8bif:D |
8 | 5h02:A | 252 | 94 | 0.1646 | 0.1032 | 0.2766 | 3.7 | 5gwx:A, 5hik:A, 5hil:A, 5him:A |
9 | 7sn8:D | 399 | 47 | 0.0886 | 0.0351 | 0.2979 | 6.2 | |
10 | 6hv8:A | 774 | 107 | 0.1709 | 0.0349 | 0.2523 | 6.9 | 6hv9:A |