SNAMDFSDDNLIWLDLEMTGLDPERDRIIEIATIVTNSHLDILAEGPAFAIHQPDKLLTAMDNWNTSHHTASGLLERVKN
SSVDEVEAETLTLAFLEKYVSAGKSPLCGNSVCQDRRFLSRYMPRLNQFFHYRHLDVTTLKILAQRWAPQIAAAHIKESQ
HLALQDIRDSIEELRYYRAHLLNL
The query sequence (length=184) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3tr8:A | 184 | 184 | 1.0000 | 1.0000 | 1.0000 | 6.03e-138 | 3tr8:B |
2 | 2igi:A | 180 | 178 | 0.5924 | 0.6056 | 0.6124 | 7.63e-82 | 2igi:B, 7vh4:C |
3 | 7va2:A | 180 | 175 | 0.5978 | 0.6111 | 0.6286 | 3.88e-80 | 7va3:A, 7va3:B, 7va6:A, 7va6:B |
4 | 6n6a:A | 181 | 181 | 0.5815 | 0.5912 | 0.5912 | 8.06e-79 | 6n6c:A, 6n6d:A, 6n6e:A, 6n6f:A, 6n6g:A, 6n6h:A |
5 | 5cy4:C | 184 | 172 | 0.5598 | 0.5598 | 0.5988 | 2.15e-77 | 5cy4:A, 5cy4:B, 5cy4:D, 5cy4:E, 5cy4:F |
6 | 6rk6:C | 178 | 174 | 0.5054 | 0.5225 | 0.5345 | 5.03e-70 | 6rk6:A, 6rk6:B |
7 | 6a4d:A | 184 | 181 | 0.5054 | 0.5054 | 0.5138 | 9.20e-66 | 6a4d:B, 6a4e:A, 6a4e:C, 6a4f:A, 6a4f:B |
8 | 6sty:A | 198 | 173 | 0.4348 | 0.4040 | 0.4624 | 8.38e-55 | 6j7y:B, 6j7z:B, 6j80:B, 6n6i:A, 6n6i:B, 6n6j:A, 6n6j:B, 6n6k:A, 6n6k:B, 6rcl:A, 6rcn:A, 6sty:B, 6sty:E |
9 | 7wik:C | 196 | 173 | 0.4185 | 0.3929 | 0.4451 | 1.87e-47 | |
10 | 6rcl:B | 148 | 173 | 0.3478 | 0.4324 | 0.3699 | 4.85e-34 | 6j7y:A, 6j7z:A, 6j80:A, 6rcn:B |
11 | 8a7e:C | 1524 | 109 | 0.1304 | 0.0157 | 0.2202 | 0.17 | 8a7d:C, 8a7e:Q, 7y5n:C, 7y5q:B |
12 | 8hgg:C | 1484 | 109 | 0.1304 | 0.0162 | 0.2202 | 0.17 | 8hgg:D, 8hgh:A, 8hgh:B |
13 | 7ufg:B | 1182 | 109 | 0.1304 | 0.0203 | 0.2202 | 1.1 | 8d8o:B |
14 | 7ufg:A | 1151 | 109 | 0.1304 | 0.0209 | 0.2202 | 1.1 | |
15 | 8f72:B | 595 | 35 | 0.0707 | 0.0218 | 0.3714 | 3.4 | 8f5m:A, 8f5m:B, 8f72:A |
16 | 3itj:B | 319 | 32 | 0.0489 | 0.0282 | 0.2812 | 4.2 | 3d8x:A, 3d8x:B, 3itj:A, 3itj:C, 3itj:D |
17 | 8skr:A | 402 | 60 | 0.1087 | 0.0498 | 0.3333 | 4.6 | 3pd6:A, 3pd6:B, 3pd6:C, 3pdb:B, 3pdb:D, 8skr:C |
18 | 6cd1:A | 452 | 34 | 0.0652 | 0.0265 | 0.3529 | 5.0 | 6ccz:A, 6ccz:B, 6cd1:B, 6cd1:C, 6cd1:D, 6cd1:E, 6cd1:F, 6cd1:G, 6cd1:H |
19 | 4pfy:A | 539 | 34 | 0.0543 | 0.0186 | 0.2941 | 5.1 | 4pft:A, 4pft:B, 4pfy:B |
20 | 8h18:A | 172 | 28 | 0.0543 | 0.0581 | 0.3571 | 7.8 | 8h2f:A |
21 | 4o4e:A | 246 | 32 | 0.0598 | 0.0447 | 0.3438 | 9.1 | 4o4d:A, 4o4f:A, 8omi:A |