SNAASRETSMDSRLQRIHAEIKNSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTM
LYNKFKNM
The query sequence (length=88) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2msr:B | 88 | 88 | 1.0000 | 1.0000 | 1.0000 | 1.85e-60 | 2n3a:B, 3u88:C |
2 | 5ksz:A | 398 | 36 | 0.1705 | 0.0377 | 0.4167 | 0.65 | 5kso:A, 5ksp:A, 5ksp:B, 5ksy:A, 5kty:A, 5ku1:A |
3 | 8jfh:E | 79 | 67 | 0.2045 | 0.2278 | 0.2687 | 0.71 | 8jfn:B |
4 | 4kpp:A | 395 | 36 | 0.1364 | 0.0304 | 0.3333 | 1.7 | 4kpp:B |
5 | 6cj6:D | 166 | 58 | 0.1705 | 0.0904 | 0.2586 | 3.0 | 6cj6:A, 6cj6:B, 6cj6:C |
6 | 4ct9:A | 394 | 41 | 0.1591 | 0.0355 | 0.3415 | 4.2 | 4cta:A, 4cta:B, 4uoc:A, 4uoc:B, 4uuw:A, 4uux:A, 4uux:B |
7 | 8dgp:A | 236 | 39 | 0.1250 | 0.0466 | 0.2821 | 5.4 | 2br9:A, 7c8e:A, 7c8e:B, 8dgm:A, 8dgn:A, 8dgp:B, 8dgp:C, 8dgp:D, 8dp5:D, 6eih:A, 8q1s:B, 8q1s:A, 3ual:A, 3ubw:A, 7v9b:A |
8 | 4py5:A | 267 | 55 | 0.1818 | 0.0599 | 0.2909 | 7.8 | |
9 | 1wow:A | 245 | 34 | 0.1364 | 0.0490 | 0.3529 | 8.8 | 1wov:A, 1wov:B, 1wow:B, 1wox:A, 1wox:B |
10 | 3jyf:A | 336 | 21 | 0.1136 | 0.0298 | 0.4762 | 8.8 | 3jyf:B |
11 | 6or5:A | 2058 | 56 | 0.1932 | 0.0083 | 0.3036 | 9.6 | |
12 | 3pr3:A | 578 | 42 | 0.1250 | 0.0190 | 0.2619 | 10.0 | 3pr3:B |