SMVRYFYDTEFIEDGHTIELISIGVVAEDGREYYAVSTEFDPERAGSWVRTHVLPKLPPPASQLWRSRQQIRLDLEEFLR
IDGTDSIELWAWVGAYDHVALCQLWGPMTALPPTVPRFTRELRQLWEDRGCPRMPPRPRDVHDALVDARDQLRRFRLITS
TDD
The query sequence (length=163) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4hec:B | 163 | 163 | 1.0000 | 1.0000 | 1.0000 | 1.44e-118 | 4hec:A, 4hvj:A, 4hvj:B, 4oke:A, 4oke:B, 4okj:A, 4okj:B, 4okk:A, 4okk:B, 6s0m:B |
2 | 7aih:S | 150 | 68 | 0.1288 | 0.1400 | 0.3088 | 0.025 | 7am2:S, 7ane:S |
3 | 5d6j:A | 630 | 59 | 0.1104 | 0.0286 | 0.3051 | 0.15 | 5ey8:A, 5ey8:B, 5ey8:C, 5ey8:D, 5ey8:E, 5ey8:F, 5ey8:G, 5ey8:H, 5icr:A, 5icr:B, 5icr:C, 5icr:D |
4 | 6pxk:K | 429 | 105 | 0.1595 | 0.0606 | 0.2476 | 0.26 | 6pxk:I, 6pxk:A, 6pxk:C, 6pxk:E, 6pxl:B, 6pxl:F, 6pxl:G, 6pxl:K |
5 | 5fv7:A | 283 | 85 | 0.1534 | 0.0883 | 0.2941 | 0.29 | 5fv7:B |
6 | 7aoi:A3 | 150 | 68 | 0.1043 | 0.1133 | 0.2500 | 1.7 | 6hiv:A3, 6hix:A3, 6yxx:A3, 6yxy:A3 |
7 | 8pjg:D | 203 | 77 | 0.1227 | 0.0985 | 0.2597 | 1.9 | 1fyt:D, 1j8h:D, 6r0e:DDD |
8 | 6xu6:DA | 350 | 43 | 0.0798 | 0.0371 | 0.3023 | 2.6 | |
9 | 6cmz:A | 462 | 42 | 0.0798 | 0.0281 | 0.3095 | 3.4 | 6cmz:B, 6cmz:C, 6cmz:D |