BioLiP

>protein
SMVMEKPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQKEIHRKVMSQNFTNCHTKIRH
VDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSVANKFYVHNDIFRYQDEVF

The query sequence (length=139) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5fw5:A	139	139	1.0000	1.0000	1.0000	9.08e-104	4fcm:A, 4fcm:B, 7suo:A, 7suo:B, 6ta7:D, 6ta7:E, 6ta7:F, 8th1:A, 8th1:B, 8th1:C, 8th1:D, 8th5:A, 8th5:C, 8th5:F, 8th5:B, 8th5:E, 8th5:D, 8th6:D, 8th6:C, 8th6:B, 8th6:A, 8th7:A, 8th7:B, 8v1l:A, 8v1l:B, 8v1l:C, 8v1l:D, 8v1l:E, 8v1l:F, 7xhf:A, 7xhf:B, 7xhg:B, 7xhg:C, 7xhg:D
2	8th5:I	119	138	0.8561	1.0000	0.8623	2.81e-77
3	5drv:A	131	138	0.7770	0.8244	0.7826	5.87e-77
4	3ujm:A	117	126	0.5468	0.6496	0.6032	2.68e-48	3ujm:B
5	1gyb:B	122	78	0.2230	0.2541	0.3974	4.79e-07	1gyb:D, 1gyb:C
6	2qiy:A	134	127	0.2302	0.2388	0.2520	5.81e-05	2qiy:B
7	3u43:B	132	80	0.1439	0.1515	0.2500	0.060
8	8ro2:L2	369	53	0.1151	0.0434	0.3019	1.7	6id0:U, 6id1:U
9	6uel:A	1333	55	0.1511	0.0158	0.3818	2.6	6uel:B
10	5ihx:A	360	50	0.0863	0.0333	0.2400	2.8
11	8hra:C	852	48	0.1223	0.0200	0.3542	3.6	8hr8:A, 8hr8:C, 8hr8:F, 8hr8:H, 8hr9:A, 8hr9:C, 8hr9:F, 8hr9:H, 8hr9:I, 8hr9:J, 8hr9:M, 8hr9:O, 8hra:D, 8hra:E, 8hra:H, 8hra:A, 8hra:B, 8hra:G, 8hrb:D, 8hrb:E, 8hrb:C, 8hrb:H, 8hrb:A, 8hrb:B, 8hrb:M, 8hrb:P, 8hrb:L, 8hrb:R, 8hrb:F, 8hrb:K, 8hrb:Q, 8hrb:G
12	8hr8:G	830	48	0.1223	0.0205	0.3542	3.8	8hr9:G, 8hr9:N
13	7u1b:A	403	115	0.1799	0.0620	0.2174	4.5
14	8e7f:A	614	34	0.0935	0.0212	0.3824	9.0
15	7w6d:A	104	27	0.0647	0.0865	0.3333	9.9	5b09:A, 7w6d:B, 7w6e:A, 7w6e:B, 7w6f:A, 7w6f:B

[Back]