SMVLLSSSWLPLNKDIEVEVVDYLPSSSVAPDLFALTLLRINDSSMKEKYDSMHEKMNAYAQIVPFDSELEIGYDGVFRD
APRSVRRVRRISATKLYLVDFGKIINYEKAKCFQLPKVFQSMPTRVSLCGLDGLTWSPVAIPSFDNIREVVKKWGQMENS
TLHAMACGFQGSINMINLFCGKSILADRLQRKGVCEYL
The query sequence (length=198) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8by5:A | 198 | 198 | 1.0000 | 1.0000 | 1.0000 | 3.63e-149 | |
2 | 6tg9:A | 949 | 73 | 0.1111 | 0.0232 | 0.3014 | 0.55 | 6tg9:E, 6tga:A, 6tga:E |
3 | 6hax:E | 121 | 78 | 0.1061 | 0.1736 | 0.2692 | 2.5 | 5dkc:A, 5dkh:A, 5dkh:B, 8g1p:G, 8g1p:H, 6hax:A, 6hay:A, 6hay:E, 6haz:A, 6haz:B, 8qjt:A, 8qjt:B, 8qjt:C, 7s4e:A, 7s4e:E, 7z6l:A, 7z76:D, 7z77:D, 7z78:A, 7z78:B, 7z78:C |
4 | 8t4e:B | 551 | 119 | 0.1768 | 0.0635 | 0.2941 | 3.1 | 8t4f:B, 8t4g:B, 8t4h:B, 8t4i:B, 8t4j:B |
5 | 2atx:A | 186 | 88 | 0.1162 | 0.1237 | 0.2614 | 3.8 | 2atx:B |
6 | 6je3:A | 858 | 140 | 0.1414 | 0.0326 | 0.2000 | 5.5 | |
7 | 6jfu:A | 884 | 140 | 0.1414 | 0.0317 | 0.2000 | 5.7 |