SMTIRFHRNDLPNLDNYQVDAVAIDTETLGLNPHRDRLCVVQISPGDGTADVIQIEAGQKKAPNLVKLLKDRSITKIFHF
The query sequence (length=206) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
7mpt:A |
206 |
206 |
1.0000 |
1.0000 |
1.0000 |
6.85e-156 |
7mpt:B, 7mpu:B |
2 |
7mpo:F |
207 |
207 |
0.7864 |
0.7826 |
0.7826 |
7.17e-117 |
7mpl:A, 7mpl:E, 7mpl:C, 7mpl:I, 7mpl:G, 7mpl:K, 7mpl:O, 7mpl:M, 7mpm:A, 7mpm:E, 7mpm:C, 7mpm:I, 7mpm:G, 7mpm:K, 7mpm:O, 7mpm:M, 7mpn:A, 7mpn:C, 7mpn:E, 7mpn:G, 7mpn:I, 7mpn:K, 7mpn:M, 7mpn:O, 7mpo:A, 7mpo:B, 7mpo:C, 7mpo:D, 7mpo:E, 7mpo:G, 7mpo:H, 7mpp:A, 7mpp:E, 7mpp:G, 7mpp:C, 7mpp:K, 7mpp:I, 7mpp:M, 7mpp:O, 7mpq:G, 7mpq:K, 7mpq:A, 7mpq:E, 7mpq:C, 7mpq:I, 7mpq:O, 7mpq:M, 7mqb:A, 7mqb:C, 7mqb:E, 7mqb:G, 7mqb:I, 7mqb:K, 7mqb:M, 7mqb:O, 7mqc:A, 7mqc:C, 7mqc:E, 7mqc:G, 7mqc:I, 7mqc:K, 7mqc:M, 7mqc:O, 7mqd:A, 7mqd:C, 7mqd:E, 7mqd:G, 7mqd:I, 7mqd:K, 7mqd:M, 7mqd:O, 7mqe:A, 7mqe:C, 7mqe:E, 7mqe:G, 7mqe:I, 7mqe:K, 7mqe:M, 7mqe:O, 7mqf:A, 7mqf:C, 7mqf:E, 7mqf:G, 7mqf:I, 7mqf:K, 7mqf:M, 7mqf:O, 7mqg:A, 7mqg:C, 7mqg:E, 7mqg:G, 7mqg:I, 7mqg:K, 7mqg:M, 7mqg:O, 7mqh:A, 7mqh:C, 7mqh:E, 7mqh:G, 7mqh:I, 7mqh:K, 7mqh:M, 7mqh:O, 7mqi:A, 7mqi:C, 7mqi:E, 7mqi:G, 7mqi:I, 7mqi:K, 7mqi:M, 7mqi:O |
3 |
5zo4:A |
207 |
207 |
0.6796 |
0.6763 |
0.6763 |
4.49e-99 |
5zo4:B, 5zo5:A, 5zo5:B |
4 |
1yt3:A |
375 |
155 |
0.2524 |
0.1387 |
0.3355 |
1.63e-16 |
|
5 |
3sah:B |
382 |
123 |
0.1748 |
0.0942 |
0.2927 |
9.61e-05 |
|
6 |
5vzj:J |
460 |
151 |
0.1845 |
0.0826 |
0.2517 |
1.16e-04 |
|
7 |
5c0w:K |
576 |
151 |
0.1845 |
0.0660 |
0.2517 |
2.04e-04 |
5c0y:B, 5c0y:A, 2hbk:A, 2hbl:A, 2hbm:A, 5k36:J, 4oo1:J, 4wfd:A |
8 |
6k18:A |
199 |
153 |
0.1796 |
0.1859 |
0.2418 |
0.064 |
6k18:B, 6k1a:A, 6k1a:B, 6k1b:A, 6k1b:B, 6k1d:A, 6k1d:B, 6k1e:A, 6k1e:B |
9 |
7c4c:A |
332 |
113 |
0.1553 |
0.0964 |
0.2832 |
0.077 |
7c42:A, 7c43:A, 7c45:A, 7c47:A, 7c4b:A |
10 |
4x8y:A |
112 |
48 |
0.0728 |
0.1339 |
0.3125 |
0.83 |
4x8y:B |
11 |
6ksy:B |
289 |
55 |
0.0825 |
0.0588 |
0.3091 |
5.9 |
6ksy:A, 6ksy:C, 6ksy:D |
12 |
1lws:A |
427 |
28 |
0.0680 |
0.0328 |
0.5000 |
7.7 |
1ef0:A, 1um2:A, 1um2:B |