SMTFGQALESLKRGHLVARKGWNGKGMFIFMRPEDSLPTNMIVNQVKSLPESFKRWVANNHDRIKFTAYLCMKAADGTIV
NGWLASQTDMLANDWVIVE
The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8kbj:B | 104 | 104 | 1.0000 | 0.9519 | 0.9519 | 8.91e-70 | 8kbj:A, 8kbj:C, 8kbj:D, 8kbk:A, 8kbk:C, 8kbk:D, 8kbk:B, 8kbl:A, 8kbm:A, 8kbm:B, 8wjc:A, 8wjc:D, 8wjc:B, 8wjc:C |
2 | 8wjd:A | 101 | 98 | 0.5657 | 0.5545 | 0.5714 | 1.71e-37 | |
3 | 8smg:B | 76 | 97 | 0.3939 | 0.5132 | 0.4021 | 2.60e-16 | 8smf:C, 8smf:H |
4 | 8smf:E | 84 | 97 | 0.3838 | 0.4524 | 0.3918 | 8.50e-16 | 8smf:D, 8smf:F, 8smf:B, 8smf:A, 8smf:G |
5 | 3j8g:X | 418 | 16 | 0.1010 | 0.0239 | 0.6250 | 0.82 | |
6 | 5a8w:D | 549 | 60 | 0.1515 | 0.0273 | 0.2500 | 0.95 | 5a8r:A, 5a8r:D, 5a8r:G, 5a8r:J, 5a8w:A, 5a8w:G, 5a8w:J |
7 | 5dn8:A | 405 | 24 | 0.1111 | 0.0272 | 0.4583 | 2.0 | |
8 | 7oq6:A | 399 | 50 | 0.1717 | 0.0426 | 0.3400 | 2.2 | 7oq6:B |
9 | 4ij6:A | 207 | 62 | 0.1717 | 0.0821 | 0.2742 | 3.9 | 4ij6:B |
10 | 4kx7:A | 875 | 50 | 0.1414 | 0.0160 | 0.2800 | 5.9 | 4kx8:A, 4kx9:A, 4kxa:A, 4kxb:A, 4kxc:A, 4kxd:A |
11 | 6bej:E | 201 | 24 | 0.1111 | 0.0547 | 0.4583 | 6.4 | 6bej:A |
12 | 1y7i:B | 262 | 36 | 0.1212 | 0.0458 | 0.3333 | 7.6 | 1xkl:A, 1xkl:B, 1xkl:C, 1xkl:D, 1y7i:A |
13 | 2hk6:A | 309 | 73 | 0.1818 | 0.0583 | 0.2466 | 9.4 | 1c1h:A, 1c9e:A, 1ld3:A, 3m4z:A, 2q2n:A, 2q2o:A, 2q3j:A |
14 | 3ecq:B | 1347 | 53 | 0.1616 | 0.0119 | 0.3019 | 9.6 | 5a55:A, 5a56:A, 5a57:A, 5a58:A, 5a59:A, 5a5a:A, 3ecq:A |