SMSVPQTKAELLLAIDKNFSKLISYLNTIPPEITSDKSMDGHAKGTEMSVRDLVSYLLGWNALVVKWIASDAKGLPVDFP
ETGYKWNQLGLLAQKFYSDYSELSYELLVAELQTVKNEIVNLINDRTDDILYGRPWYTKWTMGRMISFNTSSPYANANGR
LRKWAKNNNISL
The query sequence (length=172) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5cof:A | 172 | 172 | 1.0000 | 1.0000 | 1.0000 | 2.85e-126 | |
2 | 7mtl:A | 168 | 165 | 0.5116 | 0.5238 | 0.5333 | 3.86e-60 | 7mtl:B |
3 | 2fyf:A | 368 | 56 | 0.1337 | 0.0625 | 0.4107 | 2.7 | 2fyf:B, 3vom:A, 3vom:B |
4 | 8ppk:j | 174 | 42 | 0.0756 | 0.0747 | 0.3095 | 5.2 | |
5 | 1af0:A | 470 | 75 | 0.1453 | 0.0532 | 0.3333 | 10.0 | 5d7w:A, 4i35:A, 1sat:A, 1smp:A, 1srp:A |