SMSTYDEIEIEDMTFEPENQMFTYPCPCGDRFQIYLDDMFEGEKVAVCPSCSLMIDVVFDKEDLAEYYEEAGIHPP
The query sequence (length=76) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4d4o:A | 414 | 76 | 1.0000 | 0.1836 | 1.0000 | 4.78e-54 | 4d4o:C, 4d4p:A, 4d4p:C, 4d4p:G, 4d4p:H, 4x33:A, 4x33:B, 1yop:A, 1yws:A |
2 | 2jr7:A | 84 | 58 | 0.3947 | 0.3571 | 0.5172 | 2.10e-18 | |
3 | 1wge:A | 83 | 58 | 0.3947 | 0.3614 | 0.5172 | 2.28e-18 | |
4 | 2l6l:A | 155 | 54 | 0.1974 | 0.0968 | 0.2778 | 0.011 | |
5 | 8xq7:A | 1041 | 49 | 0.1974 | 0.0144 | 0.3061 | 0.18 | 8xq7:B |
6 | 1iyb:A | 208 | 82 | 0.2895 | 0.1058 | 0.2683 | 0.45 | 1iyb:B |
7 | 7k9s:A | 211 | 66 | 0.2500 | 0.0900 | 0.2879 | 0.79 | 7k9s:B, 7k9s:C, 7k9s:D, 7k9s:E, 7k9s:F, 7k9u:A, 7k9u:B, 7k9v:A, 7k9v:B, 7k9w:A, 7k9w:B |
8 | 1ek3:A | 114 | 36 | 0.1711 | 0.1140 | 0.3611 | 2.2 | |
9 | 4cns:D | 479 | 37 | 0.1711 | 0.0271 | 0.3514 | 2.9 | 4cns:A, 4cns:B, 4cns:C |
10 | 4b1m:A | 165 | 10 | 0.1184 | 0.0545 | 0.9000 | 4.2 | 4b1l:A, 4b1m:B, 4b1m:C |
11 | 6ras:I | 433 | 27 | 0.1316 | 0.0231 | 0.3704 | 5.3 | 6rar:I, 6rau:I, 6rce:I |