SMSTYDEIEIEDMTFEPENQMFTYPCPCGDRFQIYLDDMFEEKVAVCPSCSLMIDVVFDKEDLAEYYEEAGIHP
The query sequence (length=74) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4d4o:A | 414 | 75 | 1.0000 | 0.1787 | 0.9867 | 7.92e-51 | 4d4o:C, 4d4p:A, 4d4p:C, 4d4p:G, 4d4p:H, 4x33:A, 4x33:B, 1yop:A, 1yws:A |
2 | 1wge:A | 83 | 58 | 0.3919 | 0.3494 | 0.5000 | 1.16e-15 | |
3 | 2jr7:A | 84 | 58 | 0.3919 | 0.3452 | 0.5000 | 1.45e-15 | |
4 | 2l6l:A | 155 | 51 | 0.1757 | 0.0839 | 0.2549 | 0.001 | |
5 | 1iyb:A | 208 | 81 | 0.2838 | 0.1010 | 0.2593 | 0.54 | 1iyb:B |
6 | 4k49:C | 136 | 33 | 0.1351 | 0.0735 | 0.3030 | 3.0 | 4k49:B, 4k49:D, 4k49:A, 4k4a:A, 4k4a:B, 4k4a:D, 4k4a:C, 4k4b:A, 4k4b:B, 4k4b:C, 4k4b:D, 4k4b:E, 4k4b:F, 4k4b:G, 4k4b:H |
7 | 4b1m:A | 165 | 10 | 0.1216 | 0.0545 | 0.9000 | 4.0 | 4b1l:A, 4b1m:B, 4b1m:C |
8 | 8xq7:A | 1041 | 29 | 0.1351 | 0.0096 | 0.3448 | 7.9 | 8xq7:B |