SMSNNSYLRAKVFETEHGVCQLCNVNAQELFLRLRDAPKSQRKNLLYATWTSKLPLEQLNEMIRNPGEGHFWQVDHIKPV
YGGGGQCSLDNLQTLCTVCHKERTARQAKERSQVRRQ
The query sequence (length=117) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5mkw:A | 119 | 117 | 1.0000 | 0.9832 | 1.0000 | 7.22e-87 | 5mkw:B |
2 | 5h0m:A | 92 | 33 | 0.1282 | 0.1630 | 0.4545 | 0.002 | 5h0o:A |
3 | 6ghc:B | 286 | 41 | 0.1282 | 0.0524 | 0.3659 | 0.25 | 6ghc:A, 6r64:A, 6r64:B, 6t21:A, 6t21:B, 6t22:A, 6t22:B |
4 | 4g6f:B | 235 | 51 | 0.1368 | 0.0681 | 0.3137 | 0.84 | 4g6f:H, 5ghw:H, 5iq7:H, 5iq9:A, 5iq9:H, 4u6g:H, 4u6g:A, 6vpx:H, 6vpx:K, 6vpx:M |
5 | 7tj3:A | 164 | 66 | 0.1538 | 0.1098 | 0.2727 | 1.7 | |
6 | 4oge:A | 977 | 35 | 0.1026 | 0.0123 | 0.3429 | 1.9 | 4ogc:A |
7 | 2y88:A | 244 | 24 | 0.0855 | 0.0410 | 0.4167 | 2.0 | 2y85:A, 2y85:B, 2y85:C, 2y85:D, 3zs4:A |
8 | 3nnf:A | 318 | 45 | 0.1026 | 0.0377 | 0.2667 | 2.3 | 3nnl:A |
9 | 7twa:B | 223 | 41 | 0.1282 | 0.0673 | 0.3659 | 3.3 | 7twa:A, 7twa:C, 7twa:D |
10 | 9b59:C | 377 | 43 | 0.1368 | 0.0424 | 0.3721 | 3.6 | 9b5a:C, 9b5b:C |
11 | 8d2k:A | 1105 | 49 | 0.1368 | 0.0145 | 0.3265 | 3.7 | 8d2l:A, 8d2n:A, 8d2p:A |
12 | 8d2q:A | 906 | 49 | 0.1368 | 0.0177 | 0.3265 | 4.2 | |
13 | 3tj9:A | 155 | 34 | 0.0855 | 0.0645 | 0.2941 | 8.9 | 3ny0:B, 3tj9:B, 3tj9:C, 3tj9:D |
14 | 4ltu:A | 106 | 48 | 0.1111 | 0.1226 | 0.2708 | 9.4 | 4ltu:B |