SMSMKATRLAIPDVILFEPRVFGDDRGFFFESYNQRAFEEACGHPVSFVQDNHSRSARGVLRGLHYQIRQAQGKLVRATL
GEVFDVAVDLRRGSPTFGQWVGERLSAENKRQMWIPAGFAHGFVVLSEYAEFLYKTTDFWAPEHERCIVWNDPELKIDWP
LQDAPLLSEKDRQGKAFADADCFP
The query sequence (length=184) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2ixh:A | 184 | 184 | 0.9946 | 0.9946 | 0.9946 | 7.51e-138 | 2ixh:B, 2ixi:B, 2ixi:A, 2ixk:A, 2ixk:B |
2 | 1dzt:A | 183 | 169 | 0.6033 | 0.6066 | 0.6568 | 5.04e-82 | 1dzt:B |
3 | 6ndr:A | 188 | 183 | 0.5598 | 0.5479 | 0.5628 | 2.88e-69 | 6ndr:B |
4 | 7pvi:AAA | 199 | 176 | 0.5326 | 0.4925 | 0.5568 | 1.06e-63 | 7pvi:BBB, 7pwb:AAA, 7pwb:BBB |
5 | 1epz:A | 183 | 178 | 0.4783 | 0.4809 | 0.4944 | 1.28e-58 | |
6 | 6c46:A | 183 | 180 | 0.5054 | 0.5082 | 0.5167 | 4.69e-58 | 6c46:D |
7 | 3ryk:A | 175 | 172 | 0.4620 | 0.4857 | 0.4942 | 1.87e-54 | 3ryk:B |
8 | 2ixc:A | 198 | 179 | 0.3913 | 0.3636 | 0.4022 | 7.70e-41 | 2ixc:B, 2ixc:C, 2ixc:D |
9 | 1oi6:A | 202 | 179 | 0.3478 | 0.3168 | 0.3575 | 1.42e-35 | 1oi6:B |
10 | 7pwh:AAA | 203 | 174 | 0.3804 | 0.3448 | 0.4023 | 5.81e-35 | |
11 | 5buv:A | 174 | 181 | 0.3261 | 0.3448 | 0.3315 | 1.04e-28 | 5buv:B |
12 | 4hn1:C | 201 | 165 | 0.3152 | 0.2886 | 0.3515 | 2.84e-27 | 4hmz:A, 4hmz:B, 4hmz:C, 4hmz:D, 4hn1:A, 4hn1:B, 4hn1:D |
13 | 8dcl:A | 185 | 161 | 0.2663 | 0.2649 | 0.3043 | 4.45e-23 | 7anj:A, 7anj:B, 8dak:A, 8dak:B, 8dcl:B |
14 | 8dco:B | 181 | 161 | 0.2609 | 0.2652 | 0.2981 | 1.18e-19 | 8db5:A, 8db5:B, 8db5:C, 8db5:D, 8db5:E, 8db5:F, 8db5:G, 8db5:H, 8dco:A |
15 | 7m15:D | 181 | 161 | 0.2554 | 0.2597 | 0.2919 | 3.95e-18 | 7an4:A, 7an4:B, 7an4:D, 7m14:A, 7m14:B, 7m14:C, 7m14:D, 7m14:E, 7m14:F, 7m15:A, 7m15:B, 7m15:C, 7m15:E, 7m15:F |
16 | 2ixl:C | 197 | 177 | 0.3315 | 0.3096 | 0.3446 | 5.29e-18 | 2ixl:A, 2ixl:B, 2ixl:D, 1nyw:A, 1nyw:B, 1nzc:A, 1nzc:B, 1nzc:C, 1nzc:D |
17 | 1jvz:A | 152 | 50 | 0.0870 | 0.1053 | 0.3200 | 0.10 | |
18 | 5u8t:2 | 583 | 66 | 0.1141 | 0.0360 | 0.3182 | 0.98 | |
19 | 3dje:B | 437 | 74 | 0.1196 | 0.0503 | 0.2973 | 1.1 | 3djd:A, 3djd:B, 3dje:A |
20 | 1wf3:A | 296 | 92 | 0.1304 | 0.0811 | 0.2609 | 1.2 | |
21 | 6a0q:B | 315 | 42 | 0.0761 | 0.0444 | 0.3333 | 2.1 | |
22 | 7sgx:D | 208 | 35 | 0.0815 | 0.0721 | 0.4286 | 3.1 | 7n4p:A, 7scm:A, 7scm:B, 7sgx:A, 7sgx:B, 7sgx:C |
23 | 6khu:A | 131 | 40 | 0.0815 | 0.1145 | 0.3750 | 4.4 | |
24 | 7pt6:2 | 629 | 71 | 0.1141 | 0.0334 | 0.2958 | 7.3 | 5bk4:2, 5bk4:A, 6eyc:2, 6f0l:A, 6f0l:2, 3ja8:2, 7p30:2, 7p30:A, 7p5z:2, 7p5z:A, 7pt6:B, 7pt7:2, 7pt7:B, 6rqc:2, 6sko:2, 5u8s:2, 7v3u:2, 7v3u:B, 7v3v:2, 7v3v:B, 5v8f:2, 8w7m:2, 7w8g:2, 7w8g:B |