Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
SMSKTIVLSVGEATRTLTEIQSTADRQIFEEKVGPLVGRLRLTASLRQNGAKTAYRVNLKLDQADVVDSGLPKVRYTQVW
SHDVTIVANSTEASRKSLYDLTKSLVATSQVEDLVVNLVPLGR

The query sequence (length=123) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 8tux:ab 127 127 0.9675 0.9370 0.9370 2.01e-80 2qux:A, 2qux:B, 2qux:E, 2qux:D, 2qux:G, 2qux:H, 2qux:J, 2qux:K, 2qux:M, 2qux:N, 2qux:P, 2qux:Q
2 6yfk:AO 137 106 0.2602 0.2336 0.3019 0.007 6yfk:BG, 6yfk:AU, 6yfk:AC
3 8hkx:AS5P 204 51 0.1545 0.0931 0.3725 0.045 8hky:AS5P, 8hkz:AS5P, 8hl1:AS5P, 8hl2:AS5P, 8hl3:AS5P, 8hl4:AS5P, 8hl5:AS5P, 8wkp:AS5P, 8wq2:AS5P, 8wq4:AS5P
4 8opr:A 651 60 0.1301 0.0246 0.2667 1.1
5 4glr:H 229 71 0.1545 0.0830 0.2676 1.2 4glr:J
6 8bn5:B 267 44 0.1220 0.0562 0.3409 6.5 8blj:A, 8blj:B, 8blj:C, 8blj:D, 8blj:E, 8blj:F, 8bn2:A, 8bn2:B, 8bn5:A
7 4yo0:A 209 92 0.1789 0.1053 0.2391 6.8 4yo0:C
8 4onf:H 212 92 0.1870 0.1085 0.2500 7.1 4ong:H
9 7pkq:o 163 48 0.1138 0.0859 0.2917 7.2
10 3seq:D 650 31 0.1138 0.0215 0.4516 9.2 3dla:B, 3seq:C, 3sez:D, 3sez:C, 3syt:D, 3szg:B

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218