BioLiP

>protein
SMRPSLSDYQHVASGKVRELYRVDDEHLLFVATDRISAFDFVLDTPIPDKGRILTAMSVFFFGLLTVPNHLAGPPDDPRI
PEEVLGRALLVRRLDMLPVECVARGYLTGSGLLDYQRTGAVCGHVLPQGLGEASRLDPPLFTPATKADIGEHDMNVDFAA
VVGLVGAVRANQLRDETIKIYTRAAAHALHKGIILADTKFEFGVDIEGNLVLADEVFTPDSSRYWDAAHYQPGVVQDSFD
KQFVRNWLTGPESGWDRASDTPPPPLPDEVAVATRERYIEAYERISGLSFSDWIGPS

The query sequence (length=297) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6yx3:A	297	297	1.0000	1.0000	1.0000	0.0	6yy6:A, 6yy7:A, 6yy8:A, 6yy9:A, 6yya:A, 6yyb:A, 6yyc:A, 6yyd:A, 6z0q:A, 6z0r:A
2	1obg:A	305	296	0.4276	0.4164	0.4291	1.60e-80	2cnq:A, 2cnu:A, 2cnv:A, 1obd:A
3	4o7n:A	233	280	0.2694	0.3433	0.2857	1.02e-20	4o7l:A, 4o7r:A, 4o7s:A, 4o7t:A, 4o7v:A, 4o7w:A, 4o7y:A, 4o7z:A, 4o81:A, 4o81:B, 4o82:A, 4o82:B, 4o83:A, 4o83:B, 4o84:A, 4o84:B, 4o86:A, 3u54:A, 3u54:B
4	4fe2:B	235	220	0.2121	0.2681	0.2864	1.23e-16	4fe2:A, 4fgr:A, 4fgr:B, 4nye:A, 4nye:B
5	2z02:A	242	243	0.2189	0.2686	0.2675	4.16e-14	2yzl:A, 2z02:B
6	2gqr:A	237	239	0.2357	0.2954	0.2929	3.05e-13	2gqr:B, 2gqs:A, 2gqs:B
7	2ywv:A	237	226	0.2020	0.2532	0.2655	2.64e-12	2ywv:B
8	3nua:B	237	228	0.1919	0.2405	0.2500	5.06e-11	3nua:A
9	7ale:A	419	225	0.1785	0.1265	0.2356	4.48e-06	7ale:B, 6yb8:A, 6yb8:B, 6yb9:A, 6yb9:B
10	1qgj:A	300	57	0.0539	0.0533	0.2807	2.4	1qgj:B
11	6k8n:A	668	36	0.0404	0.0180	0.3333	3.8	6k8n:B, 6k8n:C, 6k8n:D, 6k8o:A
12	8tc8:A	435	52	0.0505	0.0345	0.2885	9.7	8h53:A, 8h53:B, 8h53:C, 8h53:D, 8tc8:B, 8tc8:C, 8tc8:D, 8tc9:A, 8tc9:B, 8tc9:C, 8tc9:D
13	6bq3:A	292	37	0.0438	0.0445	0.3514	9.7	6bq3:B, 6bq4:A, 6bq4:B, 6bq5:A, 6bq5:B, 6bq6:A, 6bq6:B, 6bq7:A, 6bq7:B

[Back]