BioLiP

>protein
SMRILLSNDDGVHAPGIQTLAKALREFADVQVVAPDRNRSGASNSLTLESSLRTFTFDNGDIAVQMGTPTDCVYLGVNAL
MRPRPDIVVSGINAGPNLGDDVIYSGTVAAAMEGRHLGFPALAVSLNGYQHYDTAAAVTCALLRGLSREPLRTGRILNVN
VPDLPLAQVKGIRVTRCGSRHPADKVIPQEDPRGNTLYWIGPDTDFAAVDEGYVSVTPLHVDLTAASAHDVVSDWLDSVG
VGTQ

The query sequence (length=244) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4xer:A	264	253	0.9959	0.9205	0.9605	1.36e-175	4g9o:A, 4g9o:B, 4gad:A, 4gad:B, 4ryt:A, 4ryu:A, 4ryu:B, 4ryu:C, 4ryu:D, 2v4n:A, 2v4o:A, 2v4o:B, 2v4o:C, 2v4o:D, 4xep:A, 4xer:B, 4xer:C, 4xer:D, 4xgb:A, 4xgb:B, 4xgb:C, 4xgb:D, 4xgp:A, 4xgp:B, 4xgp:C, 4xgp:D, 4xj7:A, 4xj7:B, 4xj7:C, 4xj7:D
2	5ksr:D	259	255	0.5574	0.5251	0.5333	2.65e-79	5ksq:A, 5ksq:B, 5ksr:A, 5ksr:B, 5ksr:C, 5kss:A, 5kss:B, 5kst:A, 5kst:B, 5kst:C, 5kst:D
3	2wqk:A	248	233	0.4303	0.4234	0.4506	6.33e-62	2wqk:B
4	4zg5:D	252	242	0.4139	0.4008	0.4174	1.37e-50	4zg5:A, 4zg5:C, 4zg5:G
5	1j9j:A	247	237	0.3730	0.3684	0.3840	1.57e-46	1j9j:B, 1j9k:A, 1j9k:B, 1j9l:A, 1j9l:B
6	2e6c:A	243	239	0.3893	0.3909	0.3975	2.35e-38	2e6b:A, 2e6b:B, 2e6b:C, 2e6b:D, 2e6c:B, 2e6c:C, 2e6c:D, 2e6h:A, 2e6h:B, 2e6h:C, 2e6h:D
7	4utu:A	229	91	0.1025	0.1092	0.2747	0.087	4utu:B, 4utw:A, 4utw:B, 4utw:C, 4utw:D
8	5fl3:A	354	56	0.0656	0.0452	0.2857	2.0
9	6gsn:p	658	53	0.0615	0.0228	0.2830	4.3	8cah:p, 8cas:p, 6fyx:p, 6fyy:p, 6gsm:p, 6zce:p, 6zu9:p
10	8iua:A	555	104	0.1148	0.0505	0.2692	4.3	8iu9:A, 8iub:A
11	4uer:b	572	53	0.0615	0.0262	0.2830	4.6
12	5bxp:A	636	43	0.0656	0.0252	0.3721	5.7	5bxp:B, 5bxr:A, 5bxr:B, 5bxs:A, 5bxs:B, 5bxt:A, 5bxt:B, 4h04:A, 4h04:B, 4jaw:A, 4jaw:B
13	7bkp:A	689	42	0.0492	0.0174	0.2857	9.7	6g19:A, 6gjz:A, 6gkh:A, 6gkm:A, 6h66:A, 7nic:A, 7niq:B

[Back]