SMKLAELTLESDDFITSDKLFNFCKSTFGAKYVKTDFIKFRQYQYIVSNCGWRDDTDVVFLENTPVLVTGHSDYDISERE
IDIIRLPNIRAWFCQNRNIPHPKVISFPLGITNKDEPNSEIHRIIGNTDRILEVSKTPKEIKNLVYMNITVKNFPEERQR
IVDLYSDKSWVTIGKGEVSEEGHRKFLEDMYAHKFCFAPRGNGIDTHRLWESLYLRTIPIVKKHIAMEQFTDLPILFVND
WENITEEYLNEQYDIIMAKDWNLDKLKIDYWYQKILEYS
The query sequence (length=279) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8asa:B | 282 | 280 | 1.0000 | 0.9894 | 0.9964 | 0.0 | 8asa:A, 8asa:C, 8asa:D, 8asa:E, 8asa:F, 8asa:G, 8asa:H, 8avq:A, 8avq:B, 8avq:C, 8avq:D, 8q8i:A |
2 | 7amv:W | 637 | 66 | 0.0753 | 0.0330 | 0.3182 | 2.1 | |
3 | 7sck:A | 642 | 65 | 0.0573 | 0.0249 | 0.2462 | 2.5 | |
4 | 7zay:A | 566 | 65 | 0.0573 | 0.0283 | 0.2462 | 2.7 | 7scj:A |
5 | 7uqx:A | 583 | 65 | 0.0573 | 0.0274 | 0.2462 | 3.0 | 7uqy:A |
6 | 4ar9:A | 392 | 99 | 0.1004 | 0.0714 | 0.2828 | 5.8 | 4ar8:A, 4ar8:B, 4ar9:B |
7 | 6xeo:A | 1118 | 39 | 0.0394 | 0.0098 | 0.2821 | 6.8 | |
8 | 6x2f:A | 1144 | 39 | 0.0394 | 0.0096 | 0.2821 | 6.9 | 7ssg:A, 6x26:A, 6x2n:A, 6x43:A, 6x4w:A, 6x4y:A, 6x50:A |
9 | 3gaz:A | 331 | 41 | 0.0358 | 0.0302 | 0.2439 | 7.0 | 3gaz:B |